KEGG   Pseudomonas mendocina ymp: Pmen_2293Help
Entry
Pmen_2293         CDS       T00510                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pmen_2293
Enzymes [BR:pmy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Pmen_2293
Exosome [BR:pmy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pmen_2293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2527253..2529391)
Genome map
AA seq 712 aa AA seqDB search
MRLRRAEEGDPFGFLGPHAQGDGTLVRVWLPGADAVELIDPEGRLLGEMQRRHADGLFEL
GLEQPSAYRLRIHWPGSVQEVEDPYAFGPILGELDLYLFAEGNHRELWRCLGARPCEHEG
VPGVSFAVWAPNARRVSVVGDFNSWDGRRHPMRLRYPAGVWELFIPRLAAGERYKYEILG
QHGLLPHKADPLAQATEAPPATASRVPRGEAFAWQDEHWMNERAQRHRPEAPLAIYELHA
ASWQWHDERTPSWDELADRLIPYVQNLGFTHIELMPIMEHPFGGSWGYQPLSLFAPTARL
GEPERFAAFVDRCHRAGLGVILDWVPGHFPNDAHGLAEFDGTALYEYAHPFEGYHPDWNT
CIHNLGRSEVHGFMLASALYWLREYHVDGLRVDAVASMLYRDYSREEGQWIPNRHGGREN
LEAIEFLQHLNEVVRSEVPGALVIAEESTAWPGVSRPVNEGGLGFSHKWNMGWMNDTLRY
FQTDPLYRRHHHQQITFGLHYAFSERYILPISHDEVVHGKRSLIGRMPGDRWQQFANLRL
FLALMWTHPGKKLLFMGCEFGQWREWNHDQQLDWYLLQYPEHGAVQALLGELNRLYREEV
ALHQWDERPEGFQWLIGDDAHNSVFAWLRHGEGGQPLLVVHNCTPQVRHDYRVGVPRAGA
WQVLLNTDEGRWCGSGAGSQGTVHSDAVANHGLHDSLNLQLPPLATLVLRPA
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgcgccgggccgaggagggtgatccgttcggtttcctcggcccgcatgcgcag
ggcgacggcacgctggtgcgcgtatggctgcccggcgccgatgccgtggagctgatcgat
cccgaaggccggctgctgggcgagatgcagcgccgtcacgccgacggcctgttcgagctc
gggctggagcagcccagcgcctatcgcctgcgcatccactggcccggcagcgtgcaggag
gtggaagacccctacgccttcggcccgattctcggcgagctggatctgtacctgttcgcc
gaaggcaaccaccgcgagctgtggcgttgtctcggcgcgcgcccctgcgaacacgagggc
gtacccggcgtgagcttcgcggtgtgggcgcccaatgcccggcgggtctcggtggtgggc
gacttcaacagctgggacggtcgtcgccacccgatgcgcctgcgctacccggccggggtg
tgggagctgttcattccgcgcctggccgctggcgagcgctacaagtacgagatcctcggc
cagcacggtctgctgccgcacaaggccgatccgctggcccaagccaccgaggcgccgccg
gcgaccgcctcgcgcgtaccgcgcggcgaagccttcgcctggcaggacgagcactggatg
aacgagcgcgcgcagcgccatcgtcccgaggcgccgctggccatctacgagctgcatgcc
gcctcctggcagtggcacgacgagcgcacgccaagctgggacgagctggccgatcggctg
attccctacgtgcagaacctggggttcacccatatcgagctgatgccgatcatggagcac
cccttcggtggctcctggggctatcagccgctgtcgctgttcgcgcccaccgcgcgcctc
ggcgagccggagcgcttcgccgccttcgtcgaccgctgccaccgcgccggcctcggcgtg
atcctcgactgggtgccgggacactttcccaacgacgcccacggtctggccgagttcgac
ggtaccgcactgtacgaatacgcccatcccttcgagggctaccacccggactggaatacc
tgcatccacaacctcggccgcagcgaggtgcacggcttcatgctggccagtgcgctgtac
tggctgcgcgagtaccacgtcgacggcctgcgcgtcgatgccgtggcctcgatgctgtat
cgcgactactcgcgcgaggaagggcagtggatccccaaccgccatggcgggcgcgagaac
ctggaggccatcgagttcctccagcacctcaacgaagtggtgcgcagcgaggtgccgggg
gcgctggtgatcgccgaggagtccaccgcctggcccggcgtcagccggccagtgaacgaa
ggtggcctgggtttcagccacaagtggaacatgggctggatgaacgacaccctgcgctac
ttccagaccgacccgctgtaccgccgccatcaccaccaacagatcaccttcgggctgcac
tacgccttctcagaacgctacatcctgcccatctcccacgacgaggtggtgcacggcaag
cgctcgctgatcgggcgcatgccgggcgatcgctggcagcagttcgccaacctgcgcctg
ttcctcgccctgatgtggacgcacccgggcaagaagctgctgttcatgggctgcgagttc
ggccagtggcgcgaatggaaccacgaccagcagctggactggtacctgctgcaatatccc
gagcatggcgcggtacaggcgctgctgggcgagctcaatcggctgtatcgcgaggaagtc
gcgctgcaccagtgggacgagcgcccggagggctttcagtggctgatcggcgacgatgcg
cacaacagcgtgttcgcctggctacgccatggcgagggtgggcaaccgctgctggtggtg
cacaactgcacgccgcaggtgcgccacgattatcgggtgggggtgccgcgcgccggcgcc
tggcaggtgctgctcaataccgacgagggccgctggtgcggctccggggcagggagccag
ggcacggtgcacagcgatgcggtggccaaccatggcctgcacgattcgctcaacctgcag
ctgccgccgctggctaccctggtgctgcgccctgcatag

DBGET integrated database retrieval system