KEGG   Pseudomonas mendocina ymp: Pmen_2353Help
Entry
Pmen_2353         CDS       T00510                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
pmy00040  Pentose and glucuronate interconversions
pmy00052  Galactose metabolism
pmy00500  Starch and sucrose metabolism
pmy00520  Amino sugar and nucleotide sugar metabolism
pmy01100  Metabolic pathways
pmy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Pmen_2353
   00052 Galactose metabolism
    Pmen_2353
   00500 Starch and sucrose metabolism
    Pmen_2353
   00520 Amino sugar and nucleotide sugar metabolism
    Pmen_2353
Enzymes [BR:pmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Pmen_2353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABP85111
JGI: Pmen2353
UniProt: A4XUU5
Position
complement(2597315..2598154)
Genome map
AA seq 279 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALEAGLNEIAIVTGRGKR
ALEDHFDVSYELEHQIKGTDKEKYLVGIRRLIDECSFAYTRQVEMKGLGHAILCGQPLIG
DEPFAVVLADDLCLNLQGDSVLAQMVKLYNQFRCSIVAIQEVPREETSKYGVIAGEMIRD
DIYRVSHMVEKPKPEDAPSNLAIIGRYILTPDIFDLIRDTPPGKGGEIQITDALMRQAQQ
GCVMAYKFKGQRFDCGSAEGYIDATNFCFENLYKTGKAY
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaatgcctgtttcccgctgccggttacggcacccgcttcctgccggctacc
aaggccatgcccaaggaaatgttgccggtggtgaacaagccgctgatccagtacggcgtc
gaggaagccctggaagcggggctgaacgagatcgccatcgtcaccggccgcggcaagcgt
gccctggaagaccatttcgacgtgagctacgagctcgaacaccagatcaagggcaccgac
aaggagaagtacctggtcggcatccgtcgtctgatcgacgagtgctccttcgcctacacc
cgtcaggtggagatgaagggcctgggccatgccattctctgcggccagccgctgatcggc
gacgagcccttcgccgtggtgctggcggacgacctgtgcctgaacctgcaaggcgatagc
gtgctggcgcagatggtcaagctgtacaaccagttccgctgctccatcgtggcgatccag
gaagtgccgcgcgaggaaacctccaagtacggcgtgatcgccggcgagatgatccgcgac
gacatctaccgcgtcagccacatggtggagaagcccaagccggaggatgccccctcgaac
ctggcgatcatcggccgctacatcctcaccccggacatcttcgacctgatccgcgatacc
ccgccgggcaagggcggcgagatccagatcaccgacgcgctgatgcgccaggcccagcag
ggctgcgtgatggcgtacaagttcaaggggcagcgtttcgactgcggcagcgccgagggc
tacatcgacgccaccaacttctgcttcgagaatctgtacaagaccggcaaggcctattga

DBGET integrated database retrieval system