KEGG   Pseudomonas mendocina ymp: Pmen_2502Help
Entry
Pmen_2502         CDS       T00510                                 

Definition
(RefSeq) dihydrolipoamide succinyltransferase (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pmen_2502
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pmen_2502
  Amino acid metabolism
   00310 Lysine degradation
    Pmen_2502
Enzymes [BR:pmy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Pmen_2502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2765323..2766555)
Genome map
AA seq 410 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKKPGEAVKRDELIVDIETDKVVIEVLAEADGVLAEII
KNEGDTVLSNELLGKLTEGGAAAAAPAAAPAAAAAPAQAAAPAAAAGDDAILSPAARKLA
EENGIDPNSIAGTGKGGRVTKEDVVAAVEAKKNAPAAAPAKPAAAPAAEAPVIATGDRTE
KRVPMTRLRAKIAERLVEAQSSMAMLTTFNEVDMTEVMALRSKYKDLFEKSHNGVRLGFM
SFFVKAATEALKRFPAVNASIDGNDIVYHGYADIGVAVSSDRGLVVPVLRNAELMSLAEI
ESGIATFGKKARDGKLSIEEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNIIQRP
MAINGQVVIRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPARLLLEI
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagccccaaccttcccggaatcggttgccgacggcaccgtcgct
acctggcataagaagccgggcgaagcggtcaagcgcgatgagctgatcgtcgacatcgaa
accgacaaggtggtgatcgaagtcctggccgaggccgacggcgtactggctgaaatcatc
aagaacgaaggcgacaccgttctttccaacgaactgctgggcaagctgaccgaaggtggc
gctgccgccgctgctccggctgccgctccggccgctgccgctgctccggctcaggctgcg
gctccggccgccgccgctggtgacgacgccatcctctcgccggccgcgcgcaagctggcc
gaagagaacggcatcgacccgaacagcatcgccggcaccggcaagggcggccgtgtgacc
aaggaagacgtggtcgctgccgtcgaagccaagaagaacgctccggctgccgcaccggcc
aagccggccgctgctcctgccgcagaagctccggtaatcgccaccggcgaccgtaccgag
aagcgcgtgccgatgacccgcctgcgtgccaagatcgccgagcgtctggtcgaggctcag
tcctccatggccatgctgaccaccttcaacgaagtggacatgaccgaagtcatggccctg
cgttcgaagtacaaggacctgttcgagaagtcccacaatggcgtgcgcctgggcttcatg
tcgttcttcgtcaaggccgctaccgaggcgctgaagcgcttcccggcagtcaacgcctcg
atcgacggcaacgacatcgtttaccacggctatgccgacatcggtgttgccgtgtccagc
gaccgtggcctggtggttccggtgctgcgcaacgccgagctgatgagcctggctgaaatc
gagagcggcattgccaccttcggcaagaaggcgcgcgacggcaagctgtcgatcgaagaa
atgactggcggtaccttcaccatcaccaacggcggtactttcggttcgatgatgtcgact
ccgatcgtcaacccgccgcaggccgcgatcctgggtatgcacaacatcatccagcgcccg
atggcgatcaatggtcaggtggtgatccgtccgatgatgtatctggcgctgtcttacgat
caccgcctgatcgatggtaaggaagccgtgaccttcctggtgaccatcaagaacttgctt
gaagatccggctcgcctgctgctggaaatctaa

DBGET integrated database retrieval system