KEGG   Pseudomonas mendocina ymp: Pmen_2506Help
Entry
Pmen_2506         CDS       T00510                                 

Definition
succinate dehydrogenase subunit D (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
pmy  Pseudomonas mendocina ymp
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pmen_2506
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pmen_2506
   00650 Butanoate metabolism
    Pmen_2506
  Energy metabolism
   00190 Oxidative phosphorylation
    Pmen_2506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2772198..2772566)
Genome map
AA seq 122 aa AA seqDB search
MVTNVTNFSRSGLYDWMAQRVSAVVLAAYTLFLLGYVICNPGMGYAEWHGLFSNTAMRIF
SLLALVALSVHAWVGMWTISTDYLTPMALGKWATGVRFLFQAVCGIAMFAMFVWGVQILW
GF
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaactaatgtcacgaatttctcgcgttcgggcctctatgactggatggcacaacgc
gtttctgcggtcgttctcgcggcttacacgctgtttctgctgggctatgtgatctgcaat
ccgggtatgggttatgccgaatggcacggcctgttctccaataccgcgatgcgcatcttc
agcctgctggcactggtagcactgagcgtgcacgcctgggtcggcatgtggaccatctcc
accgactacctgacgccgatggcgctgggcaagtgggcgactggtgtgcgtttcctgttc
caggccgtgtgcggcatcgcgatgttcgcgatgttcgtctggggcgtgcagattctgtgg
ggtttctga

DBGET integrated database retrieval system