KEGG   Pseudomonas mendocina ymp: Pmen_2522Help
Entry
Pmen_2522         CDS       T00510                                 

Definition
aminotransferase AlaT (EC:2.6.1.-)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Pmen_2522
   01230 Biosynthesis of amino acids
    Pmen_2522
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Pmen_2522
   00290 Valine, leucine and isoleucine biosynthesis
    Pmen_2522
Enzymes [BR:pmy01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Pmen_2522
    2.6.1.66  valine---pyruvate transaminase
     Pmen_2522
Amino acid related enzymes [BR:pmy01007]
 Aminotransferase (transaminase)
  Class I
   Pmen_2522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2784103..2785314
Genome map
AA seq 403 aa AA seqDB search
MQVSKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPEEILQDVIRN
LPTAQGYSDSKGLFSARKAVMQYYQQKQVEGVTIEDIYLGNGVSELIVMAMQALLNNGDE
VLIPAPDYPLWTAAVALSGGKPVHYLCDEQAGWFPDIADMRAKITPNTKALVLINPNNPT
GAVYSKEVLQDIVELARQHNLVIFSDEIYDKILYDEAVHISTASLAPDVLCLTFNGLSKS
YRVAGFRSGWVAISGPKHKAQSYIEGLDILANMRLCANVPSQHAIQTALGGYQSINDLVL
PNGRLLEQRNRAWELLNDIPGVSCVKPMGALYAFPRIDPKVCPIHNDEKFVLDLLLSEKL
LIVQGTAFNWPWPDHFRVVTLPRVDDLEQAIGRIGNFLKGYSQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcagcaaatcgaacaagctcgccaacgtctgctacgacattcgcgggccggtg
ctcaagcacgccaagcgtctggaggaggaaggccatcgcatcctcaagctgaacatcggc
aatccggcgccgttcggtttcgaggctccggaagaaattcttcaggacgtcatccgcaac
ctgcctaccgcccaaggttacagtgactccaaggggctgttcagcgcgcgcaaggcggtg
atgcagtactaccagcagaagcaggtcgaaggcgtcaccatcgaggacatctacctcggc
aacggcgtgtccgaactgatcgtcatggccatgcaggcgctgctcaacaacggtgacgag
gtgctcatcccggcgcccgactatccgctgtggaccgctgctgtggcgctgtccggcggc
aagccggtgcattacctgtgcgacgagcaggccggctggttccccgatatcgccgacatg
cgcgccaagatcacgccgaacaccaaggcgctggtactgatcaacccgaacaaccccacc
ggcgcggtgtattccaaggaagtcctgcaggacatcgtcgaactggcgcgccagcacaac
ctggtgatcttctccgacgagatctacgacaagatcctctacgacgaagccgtgcacatc
agcaccgcctcgctggcgccggacgtgctctgcctgaccttcaacggcctgtccaagagc
taccgcgtggccggcttccgttccggctgggtggccatttccgggcccaagcacaaggcg
cagagctacatcgaaggcctggatatcctcgccaacatgcgcctttgcgccaacgtgccg
agccagcatgcgatccagaccgcgctgggcggctaccagagcatcaacgacctggtactg
cccaacggccgcctgctggagcagcgcaaccgcgcctgggaactgctcaacgacataccc
ggggtgagctgcgtcaaacccatgggcgcgctgtacgccttcccgcggatcgatccgaag
gtttgcccgatccacaacgacgagaagttcgtcctcgacctgctgctgtcggagaaactg
ctgatcgtccagggcaccgccttcaactggccgtggccggaccacttccgcgtggtcacc
ctgccccgcgtcgacgacctggagcaggccatcggccgtatcggcaacttcctcaagggc
tacagccagtaa

DBGET integrated database retrieval system