KEGG   Pseudomonas mendocina ymp: Pmen_2558Help
Entry
Pmen_2558         CDS       T00510                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Pmen_2558
Enzymes [BR:pmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Pmen_2558
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Pmen_2558
Lipid biosynthesis proteins [BR:pmy01004]
 Fatty acid synthase
  Component type
   Pmen_2558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2819894..2820499)
Genome map
AA seq 201 aa AA seqDB search
MRAWWLSGALALLFWAQGAVAGTLLVVGDSISAAFGLDSRQGWVALLEKRLREQGFDHAV
VNASISGDTSAGGAARLPALLAEHRPSLVIIELGGNDGLRGQPPAQLQQNLASMIEQSQA
AGARVLLLGMRLPPNYGARYTSAFAQVFADLAEQKQVPLVPFFLEGVGGVPAMMQDDGIH
PALAAQEKLLENVWPSLQPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcatggtggctgagtggtgccttggccctgctgttctgggcccagggggcggtt
gcaggcaccctgcttgtggtcggcgatagtatcagcgcggcttttggcctggatagccgc
cagggctgggtcgccctgctggaaaagcgcctcagggagcagggtttcgaccatgcggtg
gtcaacgcttcgatcagtggcgataccagtgcaggcggcgccgcgcggctgcctgcgctg
cttgcagagcaccggccctcgctcgtgatcatcgagctgggtggcaacgatggcctgcgt
ggccagccgccggcgcaattgcaacagaatcttgcgtcgatgatcgagcagtcgcaggcc
gccggcgctcgcgtgctgttgctcggcatgcgtttgccgccgaactacggtgcccgctat
accagcgctttcgcccaggtattcgccgatctggccgagcagaagcaggttccgctggtg
ccgttcttcctcgaaggcgtcggcggtgtgccggcgatgatgcaggacgatggcatccac
cctgcgctcgctgcgcaggaaaagctgctggagaacgtctggccaagcctgcaaccgctg
ctctga

DBGET integrated database retrieval system