KEGG   Pseudomonas mendocina ymp: Pmen_2754Help
Entry
Pmen_2754         CDS       T00510                                 

Definition
guanine deaminase
Orthology
K01487  
guanine deaminase [EC:3.5.4.3]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pmy00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3028619..3029920
Genome map
AA seq 433 aa AA seqDB search
MTTDIKAYRAAILHSLADPAVVGVEQSYKYFEDGILLIENGKVAQVGPAAELLPKLAGVD
VQHYRDALITPGFIDTHIHYPQTGMIASYGEQLLDWLNTYTFPTERQFEDKAHASDVAAI
FLKELLRNGTTTALVFGTVHPQSVDAFFEQADKLNLRMIAGKVLMDRNAPDYLTDTAESG
YAESKALIERWHGKGRLHYAVTPRFAPTSTPEQLELAGKLLGEYPDLYMHTHLSENRKEI
EWVKELFPERKGYLDVYDHHKLIGPRAVFAHGVHLCDDECKRLAETGSAVAFCPTSNLFL
GSGLFDLNKLEAHGVRVGLGTDVGAGTSFSQLQSLNEAYKIMQLQGKKLDPFKSLYLATL
GGANALYLDDKLGNFLPGKDADFLVLDYNATPLMSYRMQQARSLEERLFALTMLGDDRAV
KETFAAGVSVHER
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgatatcaaagcctaccgcgccgccatcctgcacagcctcgccgaccccgcc
gtggtcggtgtcgagcagtcctacaaatatttcgaggacggcatcctgctgatcgaaaac
ggcaaggtcgcccaggttggccccgccgccgagctgttgccgaagctggccggcgtcgac
gtccagcactaccgcgacgcgctgatcacccccggcttcatcgacacccatatccactac
ccgcagaccggcatgatcgcctcctacggcgagcagttgctggactggctcaacacctac
accttccctaccgagcggcagttcgaagacaaggcccatgccagcgacgtggcggcgatc
ttcctcaaggaactgctgcgcaacggcaccaccaccgccctggtgttcggcaccgtgcac
ccacagtcggtggatgccttcttcgaacaggccgacaagctcaacctgcgcatgatcgcc
ggcaaggtgctgatggatcgcaacgccccggactacctgaccgacacagccgagtccggc
tacgccgagagcaaggcactgatcgagcgttggcacggcaagggccgcctgcactatgcg
gtcaccccgcgcttcgccccgaccagtacgccggagcaactggaactggccggcaagctg
ctgggcgagtacccggacctgtacatgcacacccacctgtccgagaaccgcaaggaaatc
gaatgggtcaaggaactgtttcccgagcgcaagggctacctggacgtctacgaccaccac
aagctgatcggcccgcgcgcggtgttcgcccatggcgtgcacctgtgcgacgacgagtgc
aagcgcctcgccgaaaccggctcggcggtggccttctgccccacctccaacctgttcctc
ggtagcggcctgttcgacctgaacaagctggaagcccatggcgtgcgcgtcgggctgggt
accgatgtcggcgccggcaccagcttcagccagctgcaatcgctgaacgaggcgtacaag
atcatgcagttgcagggcaagaagctcgatcccttcaagtcgctgtacctggccaccctg
ggcggtgccaacgccctgtacctggacgacaagctgggcaacttcctgcccggcaaggac
gccgacttcctggtgctggactacaacgccacaccgctgatgagctaccgcatgcagcag
gccaggagcctggaggaacgactgttcgccctgaccatgctcggcgatgatcgcgcggtg
aaggagaccttcgccgcgggcgtgtcagtgcacgagcgctag

DBGET integrated database retrieval system