KEGG   Pseudomonas mendocina ymp: Pmen_2955Help
Entry
Pmen_2955         CDS       T00510                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pmy00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3277707..3279476
Genome map
AA seq 589 aa AA seqDB search
MCGIAGELRFDRRPADLAAVERITHHLAPRGPDAHGFHSQGPIALGHRRLKIMDLAEASG
QPMIDSDLGLSMVFNGAIYNYPELRTELETLGYRFFSGGDTEVLLKGYHAWGEKLLPKLN
GMFAFAVWERDKQSLFIARDRLGVKPLYLSRTGERLRFASSLPALLQGGDIAKTLDAVAL
NHYLNFHAVVPAPRTILAGVEKLPPATWMRIDAEGRTEQHRWWSLEFGPRGEEAGYDFED
WREQVLGTMREAVAIRQRAAVDVGVLLSGGVDSSMLVGLLREAGVENLLTFSIGFQDAGG
ERGDEFQYSDLIARHFATRHHQLRIGEHEIIEQLPQAFRAMSEPMVSHDCIAFYLLSREV
AKHCKVVQSGQGADELFAGYHWYPLVDGADDAFAAYRAAFFDREHDEYAACVRPAWLTGD
MAGEFVREHFAQPGADAAVDKALRLDSTVMLVDDPVKRVDNMTMAWGLEARTPFLDYRVA
ELSARIPARFKLPEGGKYVLKEAARKVIPSEVIDRPKGYFPVPGLKHLEGATLGWVRDLL
LDPSQDRGLFNPTMLDQLLTNPQNQLTPLRGSKLWQLAALNLWLSEQGL
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatagcaggagaactacgttttgatcgacgccccgcggatctggcggctgtc
gaacgcatcacccaccacctggcccctcgcggcccagacgcccacggctttcacagccag
ggccccatcgccctcggccaccgccgcctgaagatcatggacctggcggaagcctcgggc
cagccgatgatcgacagcgatctcggcctgtccatggtgttcaacggcgccatctacaac
taccccgaactgcgtaccgaactggagacgctgggctatcgcttcttctccggtggcgac
accgaagtgctgctcaagggctatcacgcctggggcgaaaagctgctgcccaagctcaac
ggcatgttcgccttcgccgtgtgggagcgcgacaagcagagcctgttcatcgcccgcgac
cgcctcggcgtcaagccgctgtacctgtcgcgcaccggcgagcgcctgcgcttcgcttcc
tcgctgccggccctgctgcaaggcggcgacatcgccaagacgctggacgccgtggcgctg
aaccattacctgaatttccatgccgtggtgccggcgccgcgcaccatcctcgccggcgtg
gagaaactgccgcccgccacctggatgcgcatcgatgccgagggcaggaccgagcagcac
cgctggtggtcgctcgagttcggcccgcgaggcgaggaagcaggctacgacttcgaggac
tggcgcgaacaggtgctgggcaccatgcgcgaagcggtcgccatccgccagcgcgccgcg
gtggacgtcggcgtgctgctgtccggcggcgtcgattcgagcatgctggtcggcctgctg
cgcgaagccggggtggagaacctgctgaccttctccataggctttcaggatgccggcggt
gaacgtggcgacgaattccagtattcggatctgatcgcccgccacttcgccacccgtcat
caccagctgcgcatcggcgagcacgagattatcgagcagttgccgcaggccttccgcgcc
atgagcgagccgatggtcagccacgactgcatcgccttctacctgctctcgcgtgaagtg
gccaagcactgcaaggtggtgcagagcggccagggcgccgacgagctgttcgccggttac
cactggtacccgctggtcgacggcgccgatgacgccttcgccgcctaccgcgccgccttc
ttcgaccgcgagcatgacgagtatgccgcctgcgtgcgcccggcctggctcaccggcgac
atggccggcgagttcgttcgcgagcatttcgcccaacccggcgccgatgcggcggtggac
aaggcgctgcgcctggacagcacggtgatgctggtggacgacccggtcaagcgggtggac
aacatgaccatggcctggggcctggaagcgcgcacgccgttcctcgactaccgcgtggcc
gagctgtcggcgcgcattccggcgcgcttcaagctgcccgagggaggcaagtacgtgctc
aaggaagccgcacgcaaggtcattccaagcgaagtgatcgaccgccccaaaggctacttc
ccggtaccgggtctcaagcatctggaaggtgccaccctcggctgggtgcgcgatctgctg
cttgatcccagccaggatcgcggcctgttcaacccgaccatgctcgaccagctgctgacc
aacccgcaaaaccagctgacgccgctgcgcggttccaagctgtggcagctggcggcgctc
aacctgtggctgagcgaacagggtctgtaa

DBGET integrated database retrieval system