KEGG   Pseudomonas mendocina ymp: Pmen_3023Help
Entry
Pmen_3023         CDS       T00510                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pmy  Pseudomonas mendocina ymp
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3347678..3348352)
Genome map
AA seq 224 aa AA seqDB search
MRGQDDMQRRGIGMTSQRTRERLIQRLYEEGLSNARVLEVIRRTPRHLFVDEALAHRAYE
DTALPIGHNQTISQPYMVGRMTELLLAAGPLDKVLEIGTGSGYQTAVLAQLVERVFSVER
IQVLQDRAKERLAELSLRNVVFRWGDGWEGWNALGPYNGIIVTAAAAQVPQALLDQLAPG
GRLVIPVGAGDVQQLLLIVREEHGFSRHVLDAVRFVPLLNGPLA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggccaggacgatatgcagcgccgcgggatcggcatgacctcgcagcgcacccgt
gagcgattgattcagcgtctttacgaagaggggctgtccaacgcgcgggtgcttgaggtg
attcggcgcacgccgcgccatctgttcgtcgacgaggcgctggcgcaccgtgcctacgag
gacacggcgctgcccatcgggcacaaccagaccatttcccagccttatatggtcggccgc
atgaccgagctgctgctggctgccggcccgctggacaaggtgctggagatcggcaccggt
tccggctaccagaccgccgtgctggcgcaactggtggagcgggtgttctcggtcgagcgg
atccaggtgctgcaggaccgtgccaaggagcgtctggccgaactcagcctgcgcaacgtg
gtcttccgctggggtgatggctgggaaggttggaatgcgctggggccatacaacggcatc
atcgtcactgcggcggcggcgcaggttccgcaggcgctgctcgaccaactggcgcccggt
ggccgtctggtcatcccggtcggcgcgggagatgtgcagcaactgctgctgatcgtgcgc
gaagagcatggtttttctcgccatgtgctggatgcggtgcgtttcgtccccttactcaac
gggccgctggcctga

DBGET integrated database retrieval system