KEGG   Pseudomonas mendocina ymp: Pmen_3023Help
Entry
Pmen_3023         CDS       T00510                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pmy  Pseudomonas mendocina ymp
Brite
Enzymes [BR:pmy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Pmen_3023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 RrnaAD Methyltransf_25 NodS Methyltransf_11 Methyltransf_24 Methyltransf_23
Motif
Other DBs
NCBI-ProteinID: ABP85777
JGI: Pmen3023
UniProt: A4XWR1
Position
complement(3347678..3348352)
Genome map
AA seq 224 aa AA seqDB search
MRGQDDMQRRGIGMTSQRTRERLIQRLYEEGLSNARVLEVIRRTPRHLFVDEALAHRAYE
DTALPIGHNQTISQPYMVGRMTELLLAAGPLDKVLEIGTGSGYQTAVLAQLVERVFSVER
IQVLQDRAKERLAELSLRNVVFRWGDGWEGWNALGPYNGIIVTAAAAQVPQALLDQLAPG
GRLVIPVGAGDVQQLLLIVREEHGFSRHVLDAVRFVPLLNGPLA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggccaggacgatatgcagcgccgcgggatcggcatgacctcgcagcgcacccgt
gagcgattgattcagcgtctttacgaagaggggctgtccaacgcgcgggtgcttgaggtg
attcggcgcacgccgcgccatctgttcgtcgacgaggcgctggcgcaccgtgcctacgag
gacacggcgctgcccatcgggcacaaccagaccatttcccagccttatatggtcggccgc
atgaccgagctgctgctggctgccggcccgctggacaaggtgctggagatcggcaccggt
tccggctaccagaccgccgtgctggcgcaactggtggagcgggtgttctcggtcgagcgg
atccaggtgctgcaggaccgtgccaaggagcgtctggccgaactcagcctgcgcaacgtg
gtcttccgctggggtgatggctgggaaggttggaatgcgctggggccatacaacggcatc
atcgtcactgcggcggcggcgcaggttccgcaggcgctgctcgaccaactggcgcccggt
ggccgtctggtcatcccggtcggcgcgggagatgtgcagcaactgctgctgatcgtgcgc
gaagagcatggtttttctcgccatgtgctggatgcggtgcgtttcgtccccttactcaac
gggccgctggcctga

DBGET integrated database retrieval system