KEGG   Pseudomonas mendocina ymp: Pmen_3066Help
Entry
Pmen_3066         CDS       T00510                                 

Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pmen_3066
  Amino acid metabolism
   00300 Lysine biosynthesis
    Pmen_3066
Enzymes [BR:pmy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Pmen_3066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3393035..3394177
Genome map
AA seq 380 aa AA seqDB search
MTATLTPTLELAFDLIRRPSVTPVDEGCQELMMRRLAACGFEVERMRIEEVENFWAKRGG
DGPVLCFAGHTDVVPTGPLDAWQYQPFDVRVDEEGMLCGRGAADMKGSLASMIVAVERFV
ADYPNHRGAISFLITSDEEGPAQHGTKAVVERLRERSERLDWCIVGEPSSTTLLGDVVKN
GRRGSLGCTLTVYGKQGHVAYPHLAKNPIHLAAPALAELAAEHWDHGNDYFPPTSFQVSN
LNSGTGATNVIPGELKAVFNFRFSTESTVEGLQQRVTAILDKHGLDYHLEWALSGLPFLT
QPGELLDAVAASIKNVTGRDTTPSTSGGTSDGRFIATLGTQVVELGPVNATIHQINERVL
ASDLDLLTEVYYQTMVKLLA
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaaccctcaccccgaccctggagcttgccttcgacctgatccgccgcccgtcc
gtcaccccggtcgacgaaggctgtcaggaactgatgatgcgccgcctggccgcctgcggt
ttcgaggtggagcgcatgcgtatcgaagaggtggagaacttctgggccaaacgcggtggc
gacggcccggtgctgtgcttcgccggccacaccgacgtggtgcccaccggcccgctggac
gcctggcagtaccagccgttcgacgtacgtgtcgacgaagagggcatgctctgcggccgt
ggcgcggcggacatgaaaggcagcctggcgagcatgatcgtcgccgtcgagcgcttcgtc
gctgactatcctaaccacaggggcgccatcagtttcctgatcaccagcgacgaggaaggc
ccggcccagcacggcaccaaggccgtggtcgaacgcctgcgcgaacgcagcgagcgcctg
gactggtgcatcgtcggcgaaccgtcgagcaccaccctgctcggtgatgtggtgaagaac
ggccgccgcggctcgctcggctgcaccctgaccgtgtacggcaagcagggccacgtggcc
tacccgcatctggcgaagaacccgattcacctggccgccccggcactggccgaactggcc
gccgagcactgggatcatggcaacgactacttcccgccgaccagcttccaggtgtccaac
ctcaactccggcaccggcgccaccaacgtcatccccggtgaactgaaggcggtgttcaac
ttccgcttctccaccgaatccaccgtcgagggcctgcagcagcgcgtcaccgccatcctc
gacaagcacggcctggattaccacctggagtgggcgctgtccggcctgcccttcctcacc
cagccgggcgagctgctcgacgccgtcgccgccagcatcaagaacgtcaccggtcgcgac
accacgccgtccaccagcggcggcacctccgacggtcgcttcatcgccactctgggcacc
caggtggtcgagctcggcccggtcaacgccaccatccaccagatcaacgagcgcgtgctg
gccagcgatctcgacctgctgacagaggtgtattaccaaaccatggtcaagcttctcgca
tga

DBGET integrated database retrieval system