KEGG   Pseudomonas mendocina ymp: Pmen_3109Help
Entry
Pmen_3109         CDS       T00510                                 

Gene name
acsA
Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pmy01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pmy00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pmy00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pmy00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:pmy00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3434745..3436706)
Genome map
AA seq 653 aa AA seqDB search
MSAASIYPVSPEAAARTLTDEATYKAMYQQSVVNPEGFWREQGKRIDWIKPYTKVKQTSF
DDHHVDIKWFADGTLNVSYNCLDRHLEERGDQIAIIWEGDDPAEHKEITYRELHEQVCKF
ANALRGQDIHRGDVVTIYMPMIPEAVVAMLACARIGAIHSVVFGGFSPEALAGRIIDCQS
KVVITADEGVRGGKKVALKANVDDALTNPETHSVQKVIVVQRTGSEIKWNQHRDIWYEDL
MKVAGSVCAPKEMGAEEALFILYTSGSTGKPKGVLHTTGGYLVYASLTHERVFDYRPGEV
FWCTADIGWVTGHSYLVYGPLANGATTVMFEGVPNYPDVTRVAKIVDKHKVNILYTAPTA
IRAMMAEGKAAVAGADGSSLRLLGSVGEPINPEAWQWYYENVGQSRCPIVDTWWQTETGA
CLMTPLPGAHAMKPGSAARPFFGVQPALVDNLGNIIEGPAEGNLVIIDSWPGQARTLFGD
HDRFVDTYFKTFKGMYFTGDGARRDEDGYWWITGRVDDVLNVSGHRMGTAEIESAMVAHP
KVAEAAVVGVPHDIKGQGIYVYVTLNAGEESSEQLRQELRNWVRKEIGPIATPDVIQWAP
GLPKTRSGKIMRRILRKIATAEYEALGDISTLADPGVVQHLIDTHRQMQAACA
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctgcgtctatctatcccgtgagcccggaagcggccgccaggaccctgaccgat
gaggccacctacaaggccatgtatcagcagtcggtcgtcaacccggaaggattctggcgc
gagcaaggcaagcgcatcgactggatcaagccctacaccaaggtcaagcagacttccttc
gacgatcaccacgtcgacatcaagtggtttgccgatggcaccctgaacgtctcctacaac
tgcctggaccgtcatctggaagagcgcggcgatcagatcgcgatcatctgggaaggtgac
gaccccgccgagcacaaggagatcacctaccgcgagctgcacgagcaggtgtgcaagttc
gccaacgccctgcgcggccaggacattcaccgcggcgacgtggtgaccatctacatgccg
atgatccccgaggccgtggtggccatgctggcctgcgcccgtatcggcgccattcactcg
gtggtgttcggcggcttctctccggaagcgttggcgggccgtatcatcgactgccagtcc
aaggtggtgatcaccgccgacgaaggcgtgcgtggcggcaagaaggtggccttgaaggcc
aacgtcgacgacgcgctgaccaacccggaaacccacagcgtgcagaaggtcatcgtggtc
cagcgcaccgggtccgagatcaagtggaaccagcatcgcgacatctggtacgaagacctg
atgaaggtggccggcagcgtctgcgcgccgaaggaaatgggcgccgaggaagcgctgttc
atcctctacacctccggttccaccggcaagcccaagggcgtgctgcacaccaccggcggc
tacctggtatacgcctcgctgacccatgagcgggtgttcgactaccgtccgggcgaggtc
ttctggtgcaccgccgacatcggctgggtcaccggtcacagctacctggtctacggcccg
ctggccaacggtgccaccaccgtgatgttcgagggcgtgccgaactacccggacgtgacc
cgcgtcgccaagatcgtcgacaagcacaaggtcaacatcctctacaccgcaccgaccgcc
attcgcgccatgatggccgagggcaaggctgcagtagccggtgccgatggctccagcctg
cgcctgctgggttcggtcggcgagccgatcaacccggaagcctggcagtggtactacgag
aacgtcggccagagccgttgcccgatcgtcgacacctggtggcagaccgaaaccggcgcc
tgcctgatgaccccgctgccgggcgcgcacgccatgaagccgggctccgccgcgcgtccg
ttcttcggcgtgcagccggcactggtggacaacctgggcaacatcatcgaagggccggcc
gaaggcaacctggtgatcatcgattcctggccgggtcaggcgcgcaccctgttcggcgac
cacgaccgcttcgtcgacacctacttcaagaccttcaagggcatgtacttcaccggtgac
ggcgcgcgccgcgacgaagacggctactggtggatcaccggtcgcgtcgacgacgtgctc
aacgtttccggccaccgtatgggcaccgccgagatcgagagcgccatggtcgcccacccg
aaagtggccgaggccgcggtggtcggcgtgccgcacgacatcaaggggcagggcatctac
gtctacgtgaccctgaacgcgggcgaggaatcctccgagcaactgcgtcaggaactgagg
aactgggtgcgcaaggaaatcggtccgatcgccacaccggacgtgatccagtgggcgccg
ggcctgccgaagacccgctcgggcaagatcatgcgccgcatcctgcgcaagatcgccacc
gccgaatacgaggcactcggcgacatctccacgctggccgatcctggcgtggtgcagcac
ctcatcgatacgcatcgtcagatgcaagccgcctgcgcctga

DBGET integrated database retrieval system