KEGG   Pseudomonas mendocina ymp: Pmen_3289Help
Entry
Pmen_3289         CDS       T00510                                 

Definition
GTP cyclohydrolase (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pmen_3289
Enzymes [BR:pmy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Pmen_3289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3634471..3635031
Genome map
AA seq 186 aa AA seqDB search
MSHPLSQHYREILVGLGENPEREGLLDTPKRAAKAMQYLCHGYQQSLEEIVGGALFESDN
DEMVIVKDIELYSLCEHHLLPFIGKAHVAYIPTGKVLGLSKVARIVDMYARRLQIQENLT
KQIADAIARVTNAAGVAVVIEAKHMCMMMRGVEKQNSVMSSSVMLGAFRESCNTRHEFLQ
LIGRNN
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgagccatcctctttcccagcattaccgcgagattcttgtcggcctcggtgaaaacccc
gagcgtgaaggcctgctcgatacgcccaagcgggcggccaaggccatgcagtacctctgt
catggttatcagcagtcgctggaggaaatcgtcggcggtgccctgttcgagtccgacaac
gacgagatggtgatcgtcaaggacatcgagctgtattcgctgtgcgagcatcatctgctg
cccttcatcggcaaggcgcatgtcgcctacatcccgaccggcaaggtactcgggctgtcg
aaggtagcgcgcatcgtcgacatgtacgcgcggcgcctgcagatccaggaaaacctcacc
aagcagatcgccgacgccatcgcccgcgtcaccaacgccgccggcgtggccgtggtgatc
gaggccaagcacatgtgcatgatgatgcgcggggtggagaagcagaactcggtgatgagc
agctcggtgatgcttggcgccttccgcgagtcctgcaacactcgccatgaattcctgcaa
ttgatcggacggaacaactaa

DBGET integrated database retrieval system