KEGG   Pseudomonas mendocina ymp: Pmen_3345Help
Entry
Pmen_3345         CDS       T00510                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
Glycerolipid metabolism
Metabolic pathways
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Pmen_3345
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    Pmen_3345
Enzymes [BR:pmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Pmen_3345
Exosome [BR:pmy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pmen_3345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3692687..3694174)
Genome map
AA seq 495 aa AA seqDB search
MSKYLLAIDQGTTSSRAIIFSAQGLPVARAQQEFKQYFPQDGWVEHDGQEIWLSTLKVCR
EAIASSGLQAEAIAAIGITNQRETTLVWDAASGTPIHLAIVWQDRRTADYCAGLKDAGHE
AMVSAKTGLLIDPYFSATKLRWILENVPGARERAQRGELRFGTVDSFLLWRLTGGKVHRT
DASNASRTLMFNIHTQQWDQDLLELFDIPASLLPEVLDCAAEFGHAEAELLGASIPVLGM
AGDQQAALIGQACFEPGMVKSTYGTGCFMIQNTGDQPVSSKNRLLTTVGYRLGGKVTYAV
EGSIFVAGAAVQWLRDGIKLISHARDSEALAEATGEACGVYLVPAFTGLGAPYWDPKARG
AIFGLTRDTGIKEIVTAGLQSVCYQTRDLLEAMRQDGAAAPSALRVDGGMVENNWVMQFL
ADILGVSVERPEVTETTALGVAYLAGLQLGLYPDLQAIASHWHRQQRFEPRMSETHRERL
YAGWLDAVKRVRSEG
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaatacctgctagccatcgatcagggcaccaccagttcccgtgccatcatcttc
agtgcccagggcttgccggtggcgcgtgcccagcaggagttcaagcagtattttccgcag
gacggctgggtcgagcacgatggccaggaaatctggctgtccaccctcaaggtctgtcgc
gaggccatcgccagcagcggcctgcaggcggaggcgatcgctgccatcggcatcaccaat
cagcgtgagaccaccctggtgtgggatgccgccagcggcacgcccattcacctggccatc
gtctggcaggaccgccgtaccgccgattattgcgccggcctcaaggatgcagggcacgag
gccatggtgtcggccaagacaggtctgctgatcgacccctatttctccgccaccaagctg
cgctggatcctggaaaacgtacccggcgcccgcgagcgtgcgcagcgcggcgagctgcgc
ttcggtacggtggacagcttcctgttgtggcgcctaaccggtggcaaggtgcatcgtacc
gatgccagcaatgcctcgcgcaccctgatgttcaacatccacacccagcaatgggatcag
gacttgctcgagttgttcgacatccctgccagcctgttgcccgaggtgctcgattgcgcg
gccgagttcggtcatgccgaagccgagctgctcggtgccagtattccggtgctgggcatg
gccggcgatcagcaggcggcgctgatcggtcaggcctgcttcgagcccggcatggtcaag
agcacctatggcaccggctgtttcatgatccagaacaccggcgatcagccggtgagctcg
aagaatcgcctgctgaccaccgtcggctatcgcctgggtggcaaggtcacctacgccgtg
gagggcagcatcttcgtcgccggggcggcggtgcagtggctgcgcgacggcatcaagctg
atcagccatgcgcgtgacagcgaggcgctggccgaggccaccggcgaggcctgtggcgtc
tacctggtaccggccttcaccggcctgggcgcgccgtactgggaccccaaggcgcgcggc
gcgatcttcggcctgacccgcgataccgggatcaaggagatcgtcaccgccggcctgcag
tcggtgtgctaccagacccgcgacctgctcgaggccatgcgtcaggacggcgccgcggcg
cccagcgcgctgcgggtggacggcggcatggtggagaacaactgggtcatgcagtttctc
gccgacatcctcggggtcagcgtcgagcgccccgaggtcaccgagaccacggcgctgggg
gttgcctacctggccggcctgcaactggggctctatcccgatctgcaggccattgccagt
cactggcatcgccagcagcgcttcgagccgagaatgagcgagacgcaccgcgagcgcctc
tatgccggttggctggatgcggtgaagcgggtgcgcagcgagggctga

DBGET integrated database retrieval system