KEGG   Pseudomonas mendocina ymp: Pmen_3395Help
Entry
Pmen_3395         CDS       T00510                                 

Definition
protein-disulfide isomerase-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pmy  Pseudomonas mendocina ymp
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3752160..3752885)
Genome map
AA seq 241 aa AA seqDB search
MSLTRIPVALALLLGSGITLAADPDQAIRQSLTSLDASLPIEAIAESPMPGIYQVQLKGG
RQLYTSADGQFLIQGYLFQVKDGQAVNLTEIEESRAVAKQINSVPAKEMVVFAPKAPKTH
ITVFTDTDCGYCQKLHSEVPELNRLGVEVRYLAFPRQGLNSPAAKELVNVWCAKDQQDAM
NRAKTRQSVADATCDNPVAKQYQLGQMIGVNGTPAIVLANGKMIPGYQPAPQLAKIALES
N
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgacccgtattcccgttgccctggccctgctgctgggcagcggtatcaccctg
gctgccgatcccgatcaggccatccgccagagcctgacttcgctggatgccagcctgccg
atcgaggccatcgccgagagcccgatgccgggcatctatcaggttcagctcaagggtggg
cgccagctctacaccagcgccgacggccagttcctgatccagggttacctgttccaggtc
aaggatggccaggcggtcaatctcaccgagatcgaagagagccgtgcggtggccaagcag
atcaattccgttccggccaaggagatggtggtgttcgcgcccaaggcgccgaaaacccat
atcaccgtcttcaccgacaccgactgcggttattgccagaagctgcacagcgaagtgccg
gagctcaatcgcctgggcgtcgaggtgcgttatctggccttcccgcgccagggtcttaac
agcccggcagcgaaggagctggtcaacgtctggtgcgccaaggatcagcaggacgccatg
aaccgcgccaagacccgccagagcgtagccgatgcgacctgtgacaatccggtggccaag
cagtaccaactgggccagatgatcggggtcaacggcacgccggccatcgtgctggccaac
ggcaagatgattccgggttatcagccggcgccgcagctggccaaaattgcgctggagtcg
aactaa

DBGET integrated database retrieval system