KEGG   Pseudomonas mendocina ymp: Pmen_3511Help
Entry
Pmen_3511         CDS       T00510                                 

Definition
cysteine desulfurase
Orthology
K04487  
cysteine desulfurase [EC:2.8.1.7]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
Thiamine metabolism
Metabolic pathways
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Pmen_3511
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    Pmen_3511
Enzymes [BR:pmy01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     Pmen_3511
Transfer RNA biogenesis [BR:pmy03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    Pmen_3511
 Prokaryotic Type
    Pmen_3511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3870624..3871838)
Genome map
AA seq 404 aa AA seqDB search
MKLPIYLDYSATTPVDPRVAQKMSECLLVDGNFGNPASRSHVFGWKAEEAVENARRQVAE
LVNADPREIVWTSGATESDNLAIKGVAHFYASKGKHIITSKIEHKAVLDTTRQLEREGFE
VTYLEPGEDGLITPAMVEAALRDDTTLVSVMHVNNEIGTINDIAAIGELTRSRGVLLHVD
AAQSTGKVEIDLEKMKVDLMSFSAHKTYGPKGVGALYVRRKPRVRLEAQTHGGGHERGMR
SGTLATHQCVGMGEAFRIAKEDMAAENQRITALRDRFYRQLEGMEELYVNGSLTARVPHN
LNLSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGRNDELAHSSIRFTFGRF
TTEEEVDYAAAKVREAVDKLRELSPLWDMFKEGVDLSSVEWAAH
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgcccatttacctcgattattccgccaccacgccggtcgatccgcgtgtcgcg
cagaaaatgagcgaatgcctgctggtcgacggtaacttcggcaacccggcttcgcgctcg
cacgtattcggctggaaggccgaggaagcggtggaaaacgctcgtcgtcaggttgccgag
ctggtcaatgccgacccgcgcgagatcgtctggaccagcggtgccaccgagtccgacaac
ctcgccatcaagggcgtggcgcatttctacgctagcaagggcaaacacatcatcacctcg
aagatcgagcacaaggcggtgctggacaccacccgccagctcgagcgcgagggcttcgaa
gttacctacctcgagccgggcgaagatggcctgatcacgccggcgatggtcgaagccgcg
ctgcgtgacgacaccacgctggtgtcggtcatgcacgtcaacaacgagatcggcaccatc
aacgacatcgccgccatcggcgagctgacccgctcgcgcggtgtgctgctgcatgtcgat
gccgcgcagtccaccggcaaggtggaaatcgatctggaaaagatgaaggtcgacctgatg
tccttctccgcgcacaagacctacggcccgaaaggcgtgggcgcattgtacgtgcgccgc
aagccgcgtgtgcgcctggaagcgcagacccacggtggcggccatgagcgcggcatgcgc
tccggcaccctggccacccaccagtgcgtgggtatgggcgaagccttccgtatcgccaag
gaagacatggctgcggaaaaccagcgcatcaccgccttgcgcgaccgcttctaccgccag
ctcgaaggcatggaagagctgtacgtcaacggcagcctgactgcccgcgtgccgcacaac
ctcaacctgagcttcaactatgtcgagggcgagtcgctgatcatggcgctcaaggacctc
gccgtatcgtccggttcggcctgtacctcggcctccctggagccgtcctacgtactgcgt
gcgctgggccgcaacgacgaactggcgcatagctcgattcgcttcaccttcggtcgtttc
accaccgaagaagaggtcgactacgccgctgccaaggttcgcgaggccgtggacaagctg
cgtgaactgtcgcccctgtgggatatgttcaaagaaggtgtcgacctttcctccgtggaa
tgggcagcacactga

DBGET integrated database retrieval system