KEGG   Pseudomonas mendocina ymp: Pmen_3591Help
Entry
Pmen_3591         CDS       T00510                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pmen_3591
Enzymes [BR:pmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Pmen_3591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3961230..3961718
Genome map
AA seq 162 aa AA seqDB search
MMERVYIGLGSNLAEPLQQLRSALAALGELPQTALVAHSFFYASDPLGPPDQPRYVNAVA
ALDTELPPWELLDALQRIEQEQGRVRKAERWGPRTLDLDILLFGDRLIDDERLCVPHYHM
HARPFVLYPLAELAAELQLPDGRSLTALLAACPFTGLERLPE
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgatggagcgggtgtacatcggtctcggcagcaatctcgccgagccgctgcagcagttg
cgcagcgccctcgccgcgctcggtgagctgccgcaaacggccctggtcgctcactcattc
ttctatgccagcgacccgctcggcccgccggaccagccacgctacgtcaatgccgtggcg
gcgctggataccgagctgcccccctgggaactgctcgacgccctgcagcgcatcgagcag
gagcagggccgcgtgcgcaaggccgaacgctgggggccgcgcacgctggatctggatatc
ctgctgttcggtgacaggctgatcgacgacgagcgcctgtgcgtgccgcactaccatatg
cacgcccgccccttcgtgctctacccgctggccgagctcgcagcggagctgcagctgccg
gatggccgcagcctcaccgcactccttgccgcctgcccctttaccggcctggaacgtctg
ccggaatag

DBGET integrated database retrieval system