KEGG   Pseudomonas mendocina ymp: Pmen_3612Help
Entry
Pmen_3612         CDS       T00510                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pmen_3612 (tpiA)
   01230 Biosynthesis of amino acids
    Pmen_3612 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pmen_3612 (tpiA)
   00051 Fructose and mannose metabolism
    Pmen_3612 (tpiA)
   00562 Inositol phosphate metabolism
    Pmen_3612 (tpiA)
Enzymes [BR:pmy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Pmen_3612 (tpiA)
Exosome [BR:pmy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Pmen_3612 (tpiA)
  Exosomal proteins of bladder cancer cells
   Pmen_3612 (tpiA)
  Exosomal proteins of melanoma cells
   Pmen_3612 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3985322..3986077)
Genome map
AA seq 251 aa AA seqDB search
MRRPLVAGNWKMHGTRASVAELIEGLRRQELPVEVDVAVFPSSLHVTQVVEGLAGKAVKV
GAQDCAAQVEQGALTGELAVSQLVDGGCELVLVGHSERRLILGESDEVVVSKFAAVQKAG
LTPVLCVGETREQREANATLGVVGGQLAAVIDALGVQALNNAVVAYEPVWAIGTGLTATP
EQAQEVHAAIRAQVAQLDAQVASELRILYGGSVKAASAAELFGMQDIDGGLVGGASLNAD
EFGAICRAAGN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgccccttggtcgccggtaactggaaaatgcacggtacccgcgccagcgtcgca
gagctgatcgaagggttgcgtcggcaggagttgcctgtcgaggtggatgtcgcggtgttt
ccctccagtctgcatgtcacgcaggtcgttgaaggcctggcaggcaaggcagtgaaagtt
ggggcgcaagattgcgcagcgcaggtggagcagggcgccttgaccggtgagctggcagtg
agtcagttggtcgatggcggttgcgaactggtgctggtcggccactccgagcgtcgcctg
attctgggtgaaagtgacgaggtggtcgttagcaagttcgcggcggtgcagaaggcgggg
ctgacccctgtgctctgcgtcggtgagacccgtgagcagcgtgaggcgaatgcgacgctg
ggtgtggtgggtggtcagttggcggcggtgatagatgctcttggcgtccaggccctgaac
aacgccgttgtcgcttatgagcctgtctgggccattggcaccgggttgaccgctacgccc
gagcaagctcaggaagttcatgcggctatccgcgcgcaggtcgcgcagctggatgcgcag
gtggccagtgagctgagaattctttatggcggcagtgtaaaggccgccagtgcagccgag
ttgttcggcatgcaggatatcgatggggggcttgtaggtggcgcctctctgaatgcggat
gaattcggtgcgatctgtcgcgctgcaggaaactga

DBGET integrated database retrieval system