KEGG   Pseudomonas mendocina ymp: Pmen_4051Help
Entry
Pmen_4051         CDS       T00510                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pmy00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4435850..4436812)
Genome map
AA seq 320 aa AA seqDB search
MDQAFDNDQAITRASLYGTAAEPTYAGITSFMRRRYTRDLSGVDLAISGVPFDTATTNRP
GSRFGPRAIRAASIQSAWARHYPWEFDPFDVLACVDYGDCHFDHGTPQHTPAAIEAHATR
ILEAGAAMLTLGGDHFISYPLLKAHASKHGKLALIHFDAHSDTWPDEEVQRIDHGTMFYH
AAREGLVDPARSVQVGLRTTNDDVMGFQVLDAREVQRSTPEQIAERIRARVGDHPVYLTF
DIDCLDPAFAPGTGTPVCGGLSSHQALEILRGLRGINLVGMDVVEVAPPYDHAEVTALAG
ATLAMEMICLYAARHKLGMR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggaccaagccttcgacaacgaccaggccatcacccgcgccagcctttacggcaccgcc
gccgagcccacctacgccggcatcaccagcttcatgcgtcggcgctacacgcgcgacctc
agtggcgtggacctggccatcagcggcgtgcccttcgacaccgccaccaccaaccgcccc
ggcagccgcttcggcccgcgggcgatccgcgccgcctcgatccagtcggcctgggcgcgg
cattacccctgggagttcgatcccttcgatgtgctcgcctgcgtcgactacggcgactgc
catttcgaccacggcacgccgcagcacaccccggcggcgatcgaggcgcacgccacgcgg
atcctcgaggccggcgccgccatgcttaccctcggcggcgaccacttcatcagctacccg
ctgctcaaggcccatgccagcaagcacggcaaactggcgctgatccacttcgacgcgcac
agcgacacctggccggacgaggaggtccagcgcatcgaccacggcaccatgttctaccac
gccgcgcgcgagggcctggtggacccggcgcgttcggtgcaggtcggtttgcgcaccacc
aacgacgacgtgatgggctttcaggtactcgatgcccgcgaggtgcaacgcagcacgccg
gagcagattgccgagcgcatccgcgcacgggtgggcgaccacccggtgtacctgaccttc
gatatcgactgcctcgacccggccttcgcccccggtaccggcacgcccgtatgcggcggg
ttatccagccaccaggccctggagatcctgcgcggcctgcgcggcatcaacctggtgggc
atggacgtggtggaggtggcgccgccctacgaccacgccgaagtcaccgcgctggccggc
gccaccctggcgatggagatgatctgcctgtatgccgcgcggcataagctcggcatgcgc
tag

DBGET integrated database retrieval system