KEGG   Pseudomonas mendocina ymp: Pmen_4291Help
Entry
Pmen_4291         CDS       T00510                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Pmen_4291
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pmen_4291
Enzymes [BR:pmy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Pmen_4291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4697982..4698530
Genome map
AA seq 182 aa AA seqDB search
MKVIATALPEVLILEPQVFGDERGFFYESFNARRFAEATGVNREFVQDNHSRSARGVLRG
LHYQLQQAQGKLVRASAGEVYDVAVDVRRSSPNFGKWVGVHLSAENKRQLWVPEGFAHGF
LVLSEYAEFLYKTTDYYAPAHERCIRWDDAHLAIDWPLDGLTPQLSAKDQQGLSLQDAET
FA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagtcatcgcaactgcactaccggaagtgctgattctcgaaccccaggtattcggc
gacgagcgcggcttcttctacgaaagcttcaacgcgcggcgctttgccgaagccaccggg
gtgaaccgcgaattcgtccaggacaaccactcgcgctcggcgcgtggggtgctgcgcggc
ctgcactatcagttgcagcaggcccagggcaagctggtgcgggccagcgctggcgaggtc
tatgacgtggcggtggatgtgcggcgcagctcgccgaacttcggcaaatgggtcggcgtg
catctgtcggccgaaaacaagcgccagctatgggtgccggagggtttcgcccatggtttt
ctggtgctcagcgagtacgccgagttcctctacaagaccaccgactactacgcccccgcc
catgagcgctgcatccgctgggatgatgcgcacctggccatcgactggccgctggacgga
ctgacgccgcaactgtcggccaaggaccagcagggcctgagcctgcaggacgccgagaca
ttcgcatga

DBGET integrated database retrieval system