KEGG   Pseudomonas mendocina ymp: Pmen_4542Help
Entry
Pmen_4542         CDS       T00510                                 

Definition
serralysin (EC:3.4.24.40)
Orthology
K01406  
serralysin [EC:3.4.24.40]
Organism
pmy  Pseudomonas mendocina ymp
Brite
Enzymes [BR:pmy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.40  serralysin
     Pmen_4542
Peptidases [BR:pmy01002]
 Metallo Peptidases
  Family M10
   Pmen_4542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4976091..4979495)
Genome map
AA seq 1134 aa AA seqDB search
MTNYQQITPFSYIPLSISATVNTLLYGTKWGGGLGFPVTLTYSFANPGVSQYSTDYDDFV
EYWTGSNSSNFIYSLSSNQESAVRSALAQWSSVANLSFTEVSDTAGGTVGDLRFGGYKLI
DWDTAAFAFLPGASPLAGDVWIGPVTNEVNPSGGSYDYLTFLHEIGHALGLKHPFEASGS
SNYVLRGAYDDVRYTVMSYNDTYDFLPTGPMLYDIAAMQYIYGSNDTWQTGDNVYSWDAN
ARIFETIWDAGGNDTIDASNQSAGVVINLNSGEFSSIGQSIYNYATGAGRNNFLTIAYGS
VIENAIGSDYKDTLIGNSADNVLDGGKGEDVLRGGAGNDTYYVDLPTGSDFYDRVTEYAG
EGYDKVVLRGTSTGFFGRSFALANNVEEVDASQTGAVALTLLGNNSANRIIGNAGNNLLN
GGAGADTMIGGAGNDTYVVDHLGDEVIEQVGEGIDLVQVAIATAGGTYTLGDHVENATLT
NSVSFNLVGNTLSNTLVGNAANNLLDGGAGADVMNGGAGNDTYVVDDIGDQIIDSAGIDT
VLASISYTLGNDLENLSLLGSEALNGTGNGLANVITGNDGSNVLDGGGGVDTLRGGKGDD
TYIVDLTARNTLEDSVLENLYEGNDTIQLRGGNVALATVTAIALANNVENLDASATGTTR
LNLTGNVLNNILIGNAADNLLNGGAGADRLIGGDGNDTYVVDNLGDEVIEQAGEGTDLVQ
VAIATAGGTYTLGEHVENATLTNKVAFNLTGNALSNTLVGNAANNVLDGGLGADVMNGGA
GNDTYIVDDVGDTIIDSAGIDTVRASIAYTLGKGLENLVLTGSHAVSGTGNALANILDGS
QNNAANELRGLGGNDTYIVGAGDTVIEEANGGIDLVQAYVSYTLGDHVENLSLLGSEALN
GTGNGLANVLTGNDGSNVLDGGGGVDTLRGGKGDDTYIVDLMANNALEDRVVENANEGID
TIVLRGGSALPKAATIVLANNVENLDASGTGSIALNLTGNAANNLLIGNQGNNTLNGGDG
NDTLIGMGGFDTLTGGRGADTFRFALTWLGMNSGPDAVITDFRRLDGDKIQLQGEDAERF
SFVGRTFDTGATGSHQLRFDAGTLYGSVDSGMSNAFEIRLLGVSELRQDDFLFG
NT seq 3405 nt NT seq  +upstreamnt  +downstreamnt
ttgacgaactaccaacaaatcacgccgttttcctatataccgctaagtatttctgcgacg
gttaatacgttgctttatggcaccaaatggggtggaggacttggtttccccgttacgctg
acatacagcttcgctaatcctggcgtatcacaatattcgaccgattacgatgattttgtc
gagtactggacgggaagcaactccagtaattttatatatagcctgagctccaaccaggaa
agcgcggttcgcagtgcattggcccaatggagctcggttgccaatctctcctttaccgag
gtgagcgatacggctggcggtacggtaggtgatctgcgcttcggcggttataagcttatc
gattgggacactgcggcatttgcttttctgcctggtgcaagtccactagcgggcgatgtc
tggatcgggcctgtgaccaatgaggtcaatccttctggcggtagttacgattacctgact
tttttacatgagatcggtcatgcgctgggtctcaagcatccattcgaggcgtcaggaagc
agtaattacgtattgcgcggcgcttatgatgacgtgcgttatacggttatgagctacaac
gatacctatgactttctaccaaccggtccgatgctctacgatatcgcagccatgcagtat
atttatggcagtaacgacacatggcaaacgggagacaatgtttatagctgggatgccaat
gcgcgtatctttgaaactatctgggatgctggcggtaatgacacgattgatgccagcaat
cagagtgcaggtgtagtaattaatctaaatagtggtgaattcagctctatcggtcagagt
atatataactatgctaccggtgcagggcgtaataatttcctaaccatcgcctatggctct
gttatcgaaaatgctatcggtagtgattacaaggataccttgatcggtaatagcgccgat
aacgtgctcgatggcggtaagggtgaagatgttttgcgcgggggagctggtaacgatact
tattacgttgatcttccaaccggctcggacttttatgacagggtgaccgaatacgctggt
gagggttatgacaaggtcgttttacgtggtaccagcacaggctttttcggccgttcgttt
gccttggccaacaatgtcgaagaggtggatgccagccagacgggtgctgttgcgttgacg
ttacttggcaacaactcggcgaaccgcattatcggcaacgcgggaaacaatttactcaat
ggtggtgcaggtgccgataccatgattggcggtgccggcaacgacacctatgtggtcgat
cacctgggtgatgaggtaatcgaacaggtcggagaaggtattgatttggtgcaggttgcc
attgcgactgcaggtggtacctacaccctgggcgatcatgtcgagaacgccaccctgacc
aactcggtctcgttcaatctggtaggtaatacgctgtccaacactttggtcggcaatgct
gcaaacaatctactcgatggtggtgcaggcgctgatgtgatgaacggtggcgctgggaac
gatacctatgttgtcgacgatattggtgatcaaatcatcgatagcgcaggtatcgatacg
gttcttgccagtatttcctataccctcggcaatgacctggagaacctgagcctgctgggc
agtgaggctctcaacggcaccggcaatggattggctaacgtcatcaccggtaacgatggc
agcaacgtgctcgatggtggtggtggcgtggacacgctgcggggtggcaagggtgacgac
acctatatcgtcgacctgacggcgaggaatacgctcgaagacagcgtccttgagaacctc
tacgagggtaacgatacgatccagttgcgcggaggcaatgtggcgttggctacagtgaca
gccatcgccctggccaataacgtcgagaacctcgacgccagcgcgaccggaacaactcgc
ctgaatctgaccggtaatgtgctgaataacatcctgatcggcaatgcggcagacaacctg
ctgaatggcggcgctggtgccgatagattgattggtggcgatggtaacgatacctacgtg
gtcgacaacttgggtgacgaagtgatcgagcaggccggggagggcactgatctggtacag
gttgccatcgccacggctggcggcacctacaccttgggtgagcatgtcgagaacgccacg
cttaccaataaagtggcattcaacctgaccggcaatgcgctgagcaatactctggtcggc
aatgctgcgaacaacgtacttgatggtggcctgggtgctgacgtgatgaacggtggcgcg
ggtaatgacacctacattgtcgatgatgtgggcgatacgatcattgacagcgccggtatc
gacaccgtgcgagcgagcatcgcctacaccctgggcaagggactggaaaaccttgtgctc
acgggtagccatgccgtttctggtacgggcaatgcgctggcgaacatcctggatggttcg
cagaacaacgcagccaacgagctacggggtctaggtggcaacgatacctacatcgtcggt
gccggtgacacggttatcgaagaggccaatggcggtatcgatctggtgcaggcctacgtg
agttacaccttgggcgatcatgttgagaacctgagcctgctgggcagtgaggctctcaac
ggcaccggcaatggattggctaacgtcctcaccggtaacgatggcagtaacgtgctcgat
ggtggtggtggcgtggacacgctgcggggtggcaagggtgacgacacctatatcgtcgac
ctaatggccaataacgcgcttgaggatcgcgttgtcgaaaacgccaacgaaggcatcgac
acaatcgtcttgcgcggaggttcggcactgccgaaagccgctaccatcgttttggctaac
aacgtcgagaatctagatgctagtggaacgggcagcatcgctctcaatctcacgggcaat
gccgcgaacaacctgttgatcggtaatcagggcaacaacactctaaacggtggcgatggt
aacgacaccctcattggcatggggggcttcgacacgctgaccggtggccgcggtgccgat
accttccgcttcgccctaacttggctaggtatgaatagcggtccagatgcggtgatcacg
gactttcgtcgtctggatggcgacaagatccagttgcaaggcgaggatgcggagcgcttc
agctttgttggacgcacgttcgacacaggcgccacgggtagtcatcaattgcgttttgac
gcgggtacgctctacggctccgtggactctggtatgagtaatgctttcgaaattcgcttg
ctgggtgtgagcgagttgcgccaagacgacttcctttttggttga

DBGET integrated database retrieval system