KEGG   Pseudomonas mendocina ymp: Pmen_4623Help
Entry
Pmen_4623         CDS       T00510                                 

Definition
(GenBank) LSU ribosomal protein L34P
  KO
K02914  
large subunit ribosomal protein L34
Organism
pmy  Pseudomonas mendocina ymp
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Pmen_4623
Ribosome [BR:pmy03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    Pmen_4623
  Bacteria
    Pmen_4623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(5072230..5072364)
Genome map
AA seq 44 aa AA seqDB search
MKRTFQPSTIKRARTHGFRARMATKNGRAVLSRRRAKGRKRLTV
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcactttccaacccagcaccatcaagcgcgctcgtacccacggtttccgtgcc
cgcatggccaccaagaacggccgtgccgtcctgtcgcgtcgtcgcgccaagggccgcaag
cgtctgactgtctaa

DBGET integrated database retrieval system