KEGG   Prevotella melaninogenica: HMPREF0659_A5155Help
Entry
HMPREF0659_A5155  CDS       T01286                                 

Definition
putative 4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pmz  Prevotella melaninogenica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF0659_A5155
Enzymes [BR:pmz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     HMPREF0659_A5155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(227758..230451)
Genome map
AA seq 897 aa AA seqDB search
MNIQFHIDYQTYYGQDLVLNIITGQHNGAIEASQYRMRTSDGYHWEVEVKKDAKPGTHID
YFYSILCGNNEQRKEWGVINHRLDFDTERSFNYRVYDHWSDIPDNAYLYTSAITDCVAGK
KLVKGKLNNYNKAVTLKVRAPQLGATDELYLVGAEPALGAWNVKKALKMAQHNINEWSYT
LDATKLVGDQIEVKFFIKSNDSNENLVWEYSDNRTLLLPTMDEGDVVVYELTEASFPLPA
VRVAGTLVPVFSLRSETSFGIGDFGDLKKMVDWISKTHQRALQILPINDTTITHTWTDSY
PYSCISIFALHPQYADLTALPALKDKKQSEKFEKLRKELNALPQIDYERVNDAKTEYLRL
LFEQEGGKVLESSAFKRFFAETESWLVPYAQYSYLRDKFGTADFSHWPDHKQWDEADRKA
LSNPKNKAYKEVAFFYYVQFVLSSQLKAVHEYAQAHKIILKGDIPIGVNRYGCDVWTEPR
YFNLNGQAGAPPDDFSVNGQNWGFPTYNWDEMIKDGCQWWVNRFQNMAQYFDAYRIDHVL
GFFRIWEIPIHSVHGLLGQFAPSLGMTREEIEGYGLHWQEELFTEPFIADWVLDRIFREH
ADEVRQKYVEHVWGDRYKMRPAYDTQRKVEKAFAGKNSDVDIWLRDGLYALISDVLFIRD
HKDPNRFHPRICVQFDFIYESLYDSDKAIFNKLYNDYYYRRNNQFWYQEAMKKLPKLVNA
TRMLVCAEDLGMVPDCVAWVMNELRILSLEIQSMPKNPKVRFGHLSENPYRSVSTISTHD
MATLRQWWDEDWERTQDYFNSMLHRGGPAPHPLPGWLARDIVSRHLTSPSMLCILGIQDW
MSIDEELRLADPNAERINVPSNPKHYWRYRMHVSIEDLMKNASFNEQITDLINQAGR
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atgaacatacagtttcacatagactaccagacctattacggacaagaccttgtcttgaat
attattacaggtcaacacaatggggctatagaggcctcacagtacagaatgcgcacatct
gacggctaccactgggaggtggaagtgaagaaggatgcaaagccgggaacgcatatcgat
tatttctacagcattctctgtggtaataatgaacagcgaaaagaatggggcgtaatcaat
caccgactggattttgatacagaacgcagttttaattatcgtgtttacgaccattggagt
gacattccggacaatgcttatctctatacttctgctatcaccgattgtgttgcgggtaag
aagttagtgaagggaaaactcaataactataacaaagctgtcacactgaaggtgcgtgcg
ccacagttaggtgcaacggatgagctttatctcgtaggtgctgagcctgcattaggtgct
tggaacgtgaagaaggcactgaagatggcacagcataatatcaacgagtggagctatacc
ttagatgctaccaaacttgttggtgaccagattgaagtgaagttcttcatcaagagcaat
gatagtaatgagaatctcgtttgggaatatagcgacaaccgtaccttactattgccaaca
atggatgaaggcgacgtcgttgtctatgagttgacagaggcttctttccctctcccagct
gttcgtgttgcaggaacattggtacctgtattctcacttcgttcggagacaagtttcggt
atcggtgactttggcgatttgaagaagatggttgactggataagtaagacccaccagcgt
gcgctgcagattcttcctatcaacgacacaacaattacacacacttggacagactcttat
ccatatagctgtatttctatctttgccctccacccacagtatgctgaccttacagcatta
cctgcactgaaggacaagaagcagagtgagaagttcgagaaactacgtaaagagcttaac
gcactgccacagattgactatgagcgtgtgaacgatgcaaagacagaatacctccgtctg
ctctttgaacaggagggtggaaaggtactcgaaagcagtgctttcaagagattctttgct
gagacagagagttggcttgtgccttacgcacagtattcttatttgagagacaagttcgga
acagccgatttctctcattggccagaccataaacaatgggatgaggctgaccgcaaggca
ttgtctaaccctaagaacaaggcttacaaagaagtagctttcttctattatgtacagttc
gtattgagtagtcagctgaaagcggtacacgaatatgcacaggctcataagataatcctc
aagggtgacatccctattggtgtcaaccgctatggctgtgacgtatggacagaaccacgt
tacttcaaccttaacgggcaggcgggtgctccacctgatgacttctcagtgaatggtcag
aactgggggttccctacttacaactgggacgagatgataaaggatggttgtcagtggtgg
gtaaaccgcttccagaacatggcacagtactttgatgcttatcgtatcgaccacgtactc
ggcttcttccgtatctgggagattcctattcattcagtacacggattgctcggtcagttc
gctccatcacttggtatgactcgtgaggagattgaaggctacggtctacattggcaggaa
gaactcttcaccgagccattcattgctgattgggtactcgaccgcatcttccgtgagcat
gccgatgaggtaagacagaagtatgtggaacatgtatggggcgacagatacaagatgcgt
ccagcgtatgatacacagcgaaaggttgagaaagcctttgctggtaagaactctgatgtt
gacatctggctgcgtgacggactctatgctttgattagtgatgtacttttcattcgtgac
cataaggatccaaaccgcttccatccacgtatctgcgtacagttcgacttcatctacgag
agtctctacgatagcgataaggctatattcaataagctttacaacgattactactatcgc
cgtaacaaccagttctggtatcaggaagctatgaagaaactgccaaagttggttaatgca
actcgtatgcttgtctgtgcagaggacttgggaatggttcctgattgcgtggcatgggtg
atgaatgagctacgcatcctcagtcttgagattcaaagtatgcctaagaaccctaaagtt
cgctttggtcatcttagtgagaacccttaccgcagcgttagcaccatctctactcatgac
atggctaccctacgtcagtggtgggatgaagattgggaacgtacgcaagactacttcaat
agcatgttacatcgtggtggtcctgctcctcacccattaccaggttggttggcaagagat
atcgttagccgtcaccttacatcgccaagtatgctctgtatcctcggtattcaggactgg
atgagtattgacgaggaattgcgtttggctgaccctaatgccgagcgcatcaatgttccg
tctaatccaaagcattactggcgttaccgtatgcacgtcagcattgaagacttgatgaag
aatgcatctttcaatgagcagataacagaccttatcaatcaggcgggtcgataa

DBGET integrated database retrieval system