KEGG   Prevotella melaninogenica: HMPREF0659_A5214Help
Entry
HMPREF0659_A5214  CDS       T01286                                 

Definition
putative UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--LD-lysine ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pmz  Prevotella melaninogenica
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pmz00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    HMPREF0659_A5214
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HMPREF0659_A5214
Enzymes [BR:pmz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     HMPREF0659_A5214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(307657..309114)
Genome map
AA seq 485 aa AA seqDB search
MKLSELLKNVKVIASQGNIDVEIKGVNIDSRKIENGHLFIAMKGTQVDGHKFISKAIELG
AVAILLEDMPEELNEKVTYIQVASTEEEAGKVATMFYGEPSRKLKLVGVTGTNGKTTIAT
LLYRMFREFGHKVGLLSTVCNYINDEEVPASHTTPDPIELNCLLAKMVEAGCEYAFMECS
SHAIHQHRIGGLEFVGGIFTNLTRDHLDYHKTFENYRNAKKMFFDGLPKTAFAITNADDK
NGMIMVQNTKATVKTYSIKRMADFRAKILECHFEGMYLEVDGKEVGVQFIGKFNVSNLLA
VYGAAIMLGKKPEDVLIAMSTLKSVNGRLEPIQSPEGYTAVVDYAHTPDALENVLSAIHD
VLDGKGGHVITVCGAGGHRDKGKRPLMAQEAVKQSDTVILTSDNPRDEEPQAIIDDMLAG
LDTTQRKKVLTITDRKEAIRTAAMMAQKGDVILVAGKGHENYQEINGVKHHFDDHEVIRE
IFGIK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaagcgaattactcaaaaacgttaaggttattgccagccaaggcaatattgac
gttgagattaaaggagtgaacattgatagtcgtaagatagagaacggccacttgttcatc
gcaatgaaaggaacacaggtagacggacataaattcattagcaaagctattgagttagga
gccgtagcaattctacttgaagatatgcctgaggaactgaatgaaaaggtaacatacatt
caggtagcatcaactgaggaagaagcaggaaaggttgccacaatgttctatggagaacca
tcacgcaaactaaagttggttggtgtaactggaacgaacggtaagacaaccattgccacc
ttattatatagaatgttccgtgagttcggtcataaggtaggcttactctctaccgtatgt
aactatattaatgatgaggaagttcctgcaagtcacactactccagacccaatagaactt
aactgtctacttgccaagatggttgaggcaggctgcgaatatgcgttcatggagtgttcc
agccatgctatccatcagcatcgtataggtggtttagagtttgtaggaggcatcttcacc
aaccttacacgtgaccatctcgactaccataagactttcgagaactatcgcaatgccaag
aagatgttcttcgacggattacctaagaccgcttttgccattaccaatgccgatgacaag
aacggaatgattatggttcagaacacaaaggcaacagtcaagacctattctatcaaacga
atggcagacttccgtgcaaagattcttgaatgccactttgaaggaatgtaccttgaagtt
gacggcaaagaggttggcgtacagttcattggtaagttcaatgtgagcaatctgcttgca
gtatatggcgctgccatcatgttaggtaagaagccagaggatgtcctaatagcaatgagc
acactcaagagtgttaacggacgattagaacctatccaatcaccagaaggctacactgct
gttgttgactatgcccatacaccagacgcattggagaatgtcctcagtgctattcacgat
gtacttgatggtaagggcggacatgtcattactgtctgcggtgcaggcggacatcgtgac
aagggaaagcgtccattaatggctcaagaggctgttaaacaaagtgacactgtcatcctt
acaagtgacaatccacgcgacgaagagccacaggctattatcgatgatatgcttgcagga
cttgacactacacagcgcaagaaggttctcacgattactgatcgtaaggaagcaattcgc
actgcagccatgatggcacagaaaggtgacgttattcttgttgcaggtaagggacatgag
aactaccaagagataaatggtgtgaagcatcatttcgatgaccacgaggttatccgtgaa
atcttcggtattaagtaa

DBGET integrated database retrieval system