KEGG   Prevotella melaninogenica: HMPREF0659_A5483Help
Entry
HMPREF0659_A5483  CDS       T01286                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pmz  Prevotella melaninogenica
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HMPREF0659_A5483 (folK)
Enzymes [BR:pmz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     HMPREF0659_A5483 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(640002..640412)
Genome map
AA seq 136 aa AA seqDB search
MHIVYLSLGTNLGNRKAIMHEAIALIEKKIGTVLRQSSFHETEPWGFESPNLFLNACVCV
STSLAPRQLLETTQAIEIEMGRVKKSINAQYTDRIIDIDILLYDKLNINEPDLIIPHPLM
EEREFVMLPLKEIWED
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgcacatagtttatttatccctcggcacaaatcttggcaatagaaaggctattatgcac
gaggcgatagcattgatagaaaaaaagattggcacagttttgcgccaatcttcttttcat
gaaacggagccttgggggtttgagagtcctaatctcttcctcaatgcctgtgtatgtgtc
tccacatcgcttgctccccgacagttattagagactactcaagccatagaaatagagatg
ggacgagtaaaaaagtctatcaatgcacaatatacagaccgcatcatagatattgacatc
ctgctttacgacaagctaaatatcaatgaaccagaccttatcattccccaccctcttatg
gaagagcgtgaatttgttatgcttcctttaaaggagatatgggaggattag

  All links  
No link information was found.   
DBGET integrated database retrieval system