KEGG   Prevotella melaninogenica: HMPREF0659_A5518Help
Entry
HMPREF0659_A5518  CDS       T01286                                 

Definition
pyrazinamidase/nicotinamidase family protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pmz  Prevotella melaninogenica
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    HMPREF0659_A5518
Enzymes [BR:pmz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     HMPREF0659_A5518
    3.5.1.-  
     HMPREF0659_A5518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:685066..685614
Genome map
AA seq 182 aa AA seqDB search
MKKLLLIVDPQIDFITGTLPVAGAAEAMDALAKYVKEKGNEYTVKIVTADWHPYHHSSFA
DEGGVWPRHCVQHSVGAALWQSLLVALNESKGGFTLLYKGDSIEKDEYSIMQNEASAGVL
HQLIKALKIEQIDVCGLAGDICVLNTAKDLKNVIGSTKLNVLESYSPSLDGGTALSAFIA
SL
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagctattgttaatagtcgatccacaaatcgactttattacaggaacacttcct
gtagcaggcgcagccgaggcaatggatgcgctggcaaagtatgtaaaggaaaaaggtaat
gaatataccgtgaagattgttacagcagattggcatccttatcatcatagttcgtttgct
gatgagggtggagtatggccacgtcattgtgtacaacattctgttggagcagctctttgg
caatcactattggttgctcttaatgaatcaaagggcggcttcaccttattatataagggc
gatagcatagaaaaggatgagtattctatcatgcaaaatgaagcttctgcgggtgttctc
catcaattaattaaggctttgaagatagaacagatagatgtttgtggcttggctggagat
atctgtgtactgaatactgcaaaggatttaaagaacgttattggtagtacaaagctcaat
gtacttgaatcatattcgccttctttggacggtggaacggctttaagtgctttcattgca
agcctataa

DBGET integrated database retrieval system