KEGG   Prevotella melaninogenica: HMPREF0659_A5761Help
Entry
HMPREF0659_A5761  CDS       T01286                                 

Gene name
sucC
Definition
succinate-CoA ligase, beta subunit (EC:6.2.1.-)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pmz  Prevotella melaninogenica
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pmz01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pmz00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pmz00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(960378..961517)
Genome map
AA seq 379 aa AA seqDB search
MKVHEYQAKKFFASYGLPVDRNIICRTPDEAVEAYKQLGIEKAVVKAQVHTGGRGKAGGV
KLGCNETEIRQHAEAILGMNIKGFIVDRVLVSEAVDIASEYYMSILVDRKSKCPMLMLSR
AGGMDIEQVAKETPEKIEKIVIDPVIGMSDYLAREAAFKLFDDMAQVKQAVPIFKNIYKL
FTEKDASLAEINPLVMLKDGSLKAIDAKMTFDDNALFRHPDVAELFEPTEEERKEREAKD
KGFSYVNLGGSIGCMVNGAGLAMATMDMIKLYGGEPANFLDIGGSSNPEKIVEAMKLLLS
DKHVKVVLINIFGGITRCDDVANGLLEAFKVIETDIPIVIRLTGTNEAEGRAILEGTHFT
VGTSMADAGHKAVELSKKL
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtacatgaataccaagcaaagaaattctttgcaagttatgggcttccagtagac
cgcaatattatttgccgtactcctgatgaagctgttgaagcctacaagcaattaggtatt
gagaaagccgtagtgaaagctcaggttcacacgggtggacgtggtaaggctggtggcgtg
aaacttggctgtaatgaaactgagattcgtcagcatgcagaagctatcttaggtatgaat
atcaaggggttcattgtagacagagtacttgtcagtgaagctgtagacatcgcatcagag
tactatatgagtatccttgttgaccgtaagtcaaagtgtcctatgttaatgctgagccgt
gcaggtggtatggatatcgagcaggtagcaaaggagacaccagagaagattgagaaaatt
gtcatcgacccagttatcggaatgagcgactatcttgcacgtgaggcagccttcaaactt
ttcgatgacatggcacaggttaaacaggctgtaccaatcttcaagaatatttataaactc
tttactgagaaggatgcctcattggctgaaatcaacccattagtcatgttgaaggatggt
tctttgaaagccattgacgcaaagatgaccttcgacgataatgcccttttccgtcaccca
gatgtagccgaactttttgaacctacagaggaagaacgcaaggagcgtgaagctaaagac
aagggattcagctatgtgaaccttggaggaagcatcggttgcatggtaaatggtgctggt
cttgcaatggcaaccatggatatgattaagttatatggtggcgaaccagctaacttcctc
gatattggtggtagctctaaccctgagaagatagttgaagctatgaaacttctcttgagt
gataagcatgttaaggtagtgttaatcaatatcttcggtggtattacccgctgtgatgat
gttgcaaacggactcttggaagcattcaaggttatcgaaactgatattcctattgtcatc
cgcttaacaggaaccaacgaggcagaaggtagagccatccttgaaggaacccacttcact
gtcggcacaagtatggcagatgctggacataaagctgtagaactgagcaaaaaactttaa

DBGET integrated database retrieval system