KEGG   Prevotella melaninogenica: HMPREF0659_A6062Help
Entry
HMPREF0659_A6062  CDS       T01286                                 

Definition
beta galactosidase small chain
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
pmz  Prevotella melaninogenica
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmz00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    HMPREF0659_A6062
  Lipid metabolism
   00600 Sphingolipid metabolism
    HMPREF0659_A6062
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    HMPREF0659_A6062
Enzymes [BR:pmz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     HMPREF0659_A6062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1323053..1326181)
Genome map
AA seq 1042 aa AA seqDB search
MGMSVSGIHAQNATIEPTFTEWHDLQVNAVNRFATHTDFFAFAPFENLRGTKFDMKKSAN
YLSLDGDWKFNWVENADQRPTDFFRTDFDDSQWKTFPVPGIWEVNGYGDPVYVNIGFAWR
GNFKNNPPEVPIKENHVGSYRRTIRIPDNWDGKQVIAHFGSVTSCVYLWVNGKFVGYSED
SKIGPEFDVTKFLKKGDNQIAFQVFRWSDGSYCEDQDFWRLSGVARESYLYARDAKQHLK
DIRVTPDLVNDYKDGTLSVNLQLAGGTKAFLVLEDADNNLAAKTVVTADKAGQATAFMEL
RNPEKWTAETPYLYNLYVYVEDAKTIETIPLKVGFRKVEIKNSQVLVNGQPVLFKGANRH
EMDPDGGYVVTRERMIQDIKLMKRLNVNAVRTCHYPDDPIWYDLCDEYGLYVVAEANQES
HGFGYNKDAVSGSPLFAKQIMERNQHNVGTKFNHPSVIFWSLGNETCYSKNFDDAYDWIK
SQDQSRPVQYERAELNGYATDIFCPMYYSPKACEDYSKNTQYTRPLIQCEYNHTMGNSGG
NLKEYWDLVRKYPKFQGGFDWDFVDQGLHRNPKFDASRRLEDYERAADAVDVKTEYTYGG
DYNKTDPSDNNFNCNGMIGPDRQLNPHAYEVAYEYQNIWARPVDLKQGKIAVHNEYFFRD
LSNYRMEWSLVNEGKVVEKGAIEELNVAPQQTVEYTLPIAGKEFDGEVLLNIDFKLKTAE
PLMAAGQTVAEMQMEVQPWQPMPKMEPVAKNKVKVSDNVKEGVVRFAGNNFDLVFDRKTG
FLSSYQVDGRNFLGEGGSLKPNFWRAMTDNDMGTNFQKRLSVWKNPTMTLKSLEVDKKMN
RLTAEYDLPQVGGQLCLVYHVASDGALHVSMDMEMKEGSKAPQLPRFGMLMQLPYNMDKS
VFYGRGPIENYADRKLSQRIGCYEQTADKQFFPYIRPQETGTKSDIRWWQQTDNSGRGFR
VLFDEAVFSASALHYNISDLDEGSEKHQRHSYQVPLSKYTNLTLDAAMMGVGGIDSWGAE
PLKKYQLPAENRAMHFWIVPVF
NT seq 3129 nt NT seq  +upstreamnt  +downstreamnt
atgggcatgtctgtgtctggtattcatgcacagaacgccactattgagccaactttcacc
gaatggcatgatcttcaggtgaatgctgtcaatcgttttgcaacgcatacagacttcttt
gcgtttgcaccatttgaaaatctgcgtggaacaaagtttgatatgaagaagtcggctaat
tacctttcacttgatggggactggaagttcaattgggttgagaatgctgatcaacgtcca
acagatttcttccgtaccgatttcgatgactcgcagtggaagacattccctgttcctggt
atctgggaggtgaatggttatggcgaccctgtttatgttaacattggttttgcatggcgt
ggtaatttcaaaaacaaccctccagaggttcctattaaggaaaaccacgtaggctcttac
cgtcgtactatccgcataccagacaactgggacggcaaacaagttattgctcatttcggt
tcggtgacatcttgtgtatatctatgggtgaacggtaagttcgttggctatagtgaagac
tctaagattggaccagagtttgacgtaacgaagttcctcaagaaaggggataaccagatt
gcttttcaagtattccgttggtcagatggcagctattgtgaggaccaagacttctggcgt
ctcagtggtgttgctcgtgaaagttatctctatgcccgtgatgcaaagcagcatttgaaa
gacattcgtgtaactcctgacctcgtaaatgattacaaggacggtacgcttagcgtcaat
ctccagttggcaggtggcacaaaagctttcttagtcttggaggatgcagacaataacctt
gctgcaaagacagtcgttacggcagacaaggctggacaggctacggcttttatggaactc
agaaacccagagaagtggactgctgaaactccttatctctacaatctctatgtttatgta
gaggatgccaagactattgagactatcccgctcaaagttggtttccgtaaggttgaaatc
aagaactcgcaggtattagtcaatggtcaacctgttctcttcaagggagctaaccgtcat
gagatggatccagatggtggttacgttgtgacacgtgagcgcatgattcaggatatcaaa
ctgatgaagcgtttgaatgtcaatgcagtgcgtacttgtcactatcctgacgatcctatt
tggtatgacctatgcgacgagtatggactctatgtggttgctgaggctaatcaagaaagc
cacggttttggctataataaggatgcagtgtcgggtagtccgctttttgctaagcagatt
atggagcgtaatcagcataatgtcggaacgaagttcaatcatccaagtgtcattttctgg
agtcttggtaacgagacttgctacagcaagaacttcgatgatgcatacgattggattaag
tcgcaagaccaaagccgtcctgtacagtatgagcgtgctgagttgaatggctatgctacg
gatattttctgcccaatgtactattctccaaaagcttgtgaggattactcaaagaacact
caatacactcgtccacttatccagtgcgagtataaccatacgatgggtaactctggtggt
aacttgaaggagtactgggaccttgttcgtaagtatcctaagttccaaggtggatttgat
tgggactttgtagatcaaggcttacaccgcaatcctaagtttgatgcttctcgtaggttg
gaagactatgagcgtgcggctgatgcggttgatgtgaagacggaatacacatacggtggt
gactataataagactgacccatcagacaacaacttcaactgcaatggtatgattggtcct
gaccgtcagttgaatccacatgcttatgaggttgcctatgaatatcagaatatctgggct
cgaccagttgacctcaagcagggcaagatagctgttcacaacgaatacttcttccgtgat
ctaagcaactatcgtatggaatggagccttgttaacgagggtaaggttgttgagaagggt
gcgattgaagaactgaatgttgcaccacagcagacagttgaatacacattgccaatagct
ggtaaggagtttgatggtgaagttctcttgaatatcgactttaagttgaaaactgctgag
ccattgatggcagctggtcagactgtagcagagatgcagatggaggtgcagccttggcaa
ccgatgccaaagatggagcctgttgcaaagaataaggtgaaggtaagtgacaatgtgaaa
gaaggagttgtacgctttgcaggcaacaacttcgatcttgtattcgatcgcaagacaggt
ttcctcagcagttatcaggttgatggtcgtaacttcttgggcgaaggtggtagcttgaaa
cctaacttctggcgtgctatgacagacaatgatatgggtactaacttccaaaaacgcctg
tctgtatggaagaatcctacaatgacattgaagtcattagaggttgataaaaagatgaat
cgcctcacagcagaatatgatttgccacaggtaggtgggcagttgtgccttgtttaccat
gttgcaagcgatggtgcgctccatgtaagtatggatatggaaatgaaggagggtagtaag
gctcctcagcttccacgtttcggaatgttgatgcagttgccttataatatggataagtcg
gtgttctacggtcgtggacctatcgagaactatgccgatcgtaagctttcacagcgcatc
ggatgctatgagcagactgctgacaagcagttcttcccttacattcgtccacaggaaaca
ggtacgaagagcgacattcgctggtggcagcagactgacaacagcggtcgtggattccga
gtattgtttgatgaggctgtattctctgcgagtgcattgcactataacatctctgacctt
gatgagggaagtgagaagcatcagcgtcatagctatcaggtaccattgtctaagtacact
aacctcacgttggatgccgcaatgatgggtgtaggtggtattgatagttggggtgctgaa
cctctgaagaagtatcagttgccagctgaaaaccgagctatgcacttctggattgtgcca
gtgttctaa

DBGET integrated database retrieval system