KEGG   Prevotella melaninogenica: HMPREF0659_A6322Help
Entry
HMPREF0659_A6322  CDS       T01286                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
pmz  Prevotella melaninogenica
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pmz00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    HMPREF0659_A6322
  Lipid metabolism
   00561 Glycerolipid metabolism
    HMPREF0659_A6322
   00600 Sphingolipid metabolism
    HMPREF0659_A6322
Enzymes [BR:pmz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     HMPREF0659_A6322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1673718..1674947
Genome map
AA seq 409 aa AA seqDB search
MIEQLSKLRKSLLFIAAFLLASLHMTATNRDSLALTPPMGFMTWNKYKEDINEQLIRQIA
DKMAADGYAEAGYKYIFIDDAWQGGRDKRNNIIPDPKKFPSGIKALADYVHSKGLLLGIY
SDAAQLTCAGYTASYDFEEQDAKTFAEWGIDYLKYDYCHAPSDSAIAHKRYKKMADALQN
SGRKIALGVCEWGQLNPEMWARQAGGSLWRVSFDVRDMWKDIVKQGGMGIIDIINITEPL
YKYAGPSHWLDMDMLVVGLDGKGGPSSDLGGVGCTYTEYQTQMSMWCMFASPLAVSHDIL
NENAETRHILLNKEIIAINQDALGEAAHRVDFPGACRVYLRNLNGNRQAIAIMNPSDTPQ
RVQLPLSILGNAKEYNFRDVWEHKTSRQRKAWQATLQPHETKVFTVTTR
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgattgagcaactatctaaacttcgtaaatcacttttgtttattgcagcctttctgctg
gcttcattgcacatgactgctactaatcgtgactctttagcactgacacctccaatgggt
tttatgacttggaacaaatataaggaggacatcaacgaacagcttatccgacaaattgct
gacaagatggcggctgatggctatgctgaagctggatataaatacatcttcattgatgat
gcatggcagggaggacgcgacaaacgcaataatatcataccagaccctaagaagttccca
agcggaataaaggcactcgcagactatgttcactcaaagggtttgctgctcggtatctac
tctgatgctgctcagctcacttgtgctggttacactgccagttacgattttgaggaacaa
gatgccaagacctttgctgaatggggaattgactatctgaaatacgactactgccacgca
ccttctgacagtgctattgcccacaaacgctataagaagatggctgatgcgctacaaaat
tcaggtcgtaagattgccttgggtgtctgcgaatggggacagttgaatcctgagatgtgg
gctcgtcaggctggtggttcactctggcgtgtgagctttgacgtacgtgatatgtggaaa
gacatcgtgaagcagggaggtatgggtatcattgatatcatcaacattaccgaaccactt
tacaaatacgcaggaccgagtcactggctcgacatggatatgctcgtcgttggactcgac
ggaaagggtggaccatcaagcgatttaggtggtgtaggctgtacttatacagaatatcag
acacagatgtctatgtggtgcatgttcgcttcaccattggcagtaagccacgacatctta
aacgagaacgctgaaacacgtcacatcctcctcaataaggagattattgctatcaatcaa
gatgcgcttggcgaggcagcccatagagttgactttcctggtgcatgtcgtgtgtacctc
agaaacctaaacggaaaccgtcaggcaattgccatcatgaatccttctgacacccctcag
cgtgttcagttgccactttctatcctcggtaatgcgaaggaatacaatttcagagacgta
tgggagcataagacaagccgccaacgtaaggcgtggcaagctaccttacaacctcatgaa
acaaaggtttttacggttacaacacgctaa

DBGET integrated database retrieval system