KEGG   Prevotella melaninogenica: HMPREF0659_A6476Help
Entry
HMPREF0659_A6476  CDS       T01286                                 

Definition
putative aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
pmz  Prevotella melaninogenica
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pmz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0659_A6476
   00052 Galactose metabolism
    HMPREF0659_A6476
Enzymes [BR:pmz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     HMPREF0659_A6476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(73963..75054)
Genome map
AA seq 363 aa AA seqDB search
MVNTEETHYACGLKKEDFQTTIGGKKTDLYVLRNAKGNEVAVTNYGGAIVAIMVPDKEGK
LANVIQGHDNIQEVIASPEPYLSTLIGRYGNRIAKGRFQLNGKEYKLAINNGPNSLHGGK
EGFNAKVWDAVQVNDHAVVLKYISSYGEEGYTGEVEVWVAYSFSDNDELIIKYSAKTNKK
TIINLTSHGFFSLAGIANPTPTIDDLECQINADFYLPIDETSIPTGEILKVAGTPFDFRE
PKAVGQDIDADHEQITNGAGYDHCFVLNKKEEGELSFAARIKEPKSGRTMEVYTTEPGVQ
VYTHNWADGYKGQHGATFPRRSAICFEAQHFPDSPNHPYFPSVILEPCKEYTQRTIYKFG
VEK
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggtaaataccgaagagacacactacgcgtgtggactgaaaaaagaagacttccagacg
acaataggcggtaagaaaaccgatctttatgtactcagaaatgccaagggcaatgaggtt
gcagtcactaattacggtggtgcgattgttgctattatggttcctgacaaagaaggtaaa
ttagcaaatgtcattcaaggacatgacaatatacaagaggttatcgcctcaccagagcct
tatctttcaacacttattggccgttatggcaaccgtattgctaaaggtcgtttccagttg
aacggaaaggagtataaacttgctattaataatggtcctaactctctgcatggaggtaag
gagggctttaacgcaaaggtatgggatgcagtacaagttaacgaccacgccgttgttttg
aagtacatttcttcttatggagaggaaggctatacaggcgaagttgaagtctgggtagcc
tattcattctctgataacgacgaactcattatcaagtattctgccaagacaaacaagaag
acgattatcaatcttaccagtcatggattcttctctttggcaggtattgctaatcctaca
ccaacaattgacgacttagaatgccagataaacgcagacttctatcttcctattgacgaa
acatccatcccaacaggtgagattttgaaggtagctggtactccattcgacttccgtgag
ccaaaggcagtaggtcaggatatcgacgctgaccacgaacagattacgaatggcgcaggt
tacgaccactgtttcgtactgaataagaaggaagaaggcgagctatcattcgctgcacgc
atcaaagaaccaaagagtggcagaacaatggaggtgtatacaacagagccaggtgttcaa
gtatatacccataactgggctgacggctataagggacagcatggtgcaaccttcccacgt
cgcagtgctatctgcttcgaagcacagcacttcccagacagtccaaaccacccttatttc
ccttcagtcatcttagagccatgtaaggagtacacacagagaacgatttataagttcggt
gtagagaaataa

DBGET integrated database retrieval system