KEGG   Prevotella melaninogenica: HMPREF0659_A6485Help
Entry
HMPREF0659_A6485  CDS       T01286                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pmz  Prevotella melaninogenica
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pmz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0659_A6485 (pfkA)
   01230 Biosynthesis of amino acids
    HMPREF0659_A6485 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0659_A6485 (pfkA)
   00030 Pentose phosphate pathway
    HMPREF0659_A6485 (pfkA)
   00051 Fructose and mannose metabolism
    HMPREF0659_A6485 (pfkA)
   00052 Galactose metabolism
    HMPREF0659_A6485 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    HMPREF0659_A6485 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    HMPREF0659_A6485 (pfkA)
Enzymes [BR:pmz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HMPREF0659_A6485 (pfkA)
Protein phosphatases and associated proteins [BR:pmz01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HMPREF0659_A6485 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:84665..85642
Genome map
AA seq 325 aa AA seqDB search
MGKIKTIGILTSGGDAPGMNAAIRAVTRAGIYNGFEIKGVYRGYEGLITDDIKPFTTENV
SGIIGQGGTILKTARSKGFKTMEGRQQAYDNLVKEGIDALVVIGGNGSLTGAMMFAQEFD
FCCIGLPGTIDNDLYGTDSTIGYDTTMNTIMECVDRIRDTAQSHERIFFVEVMGRDAGFL
AQNSAIASGAEAAIIPEDSTNVDQLGRFMERGIRKSKRSCIVIVSESPKCGAMYYADRVR
KEFPDYDVRVSILGHLQRGGRPSARDRILASSTGVGAIEAIMQGQRNIMVGVRNNEVVYV
PLSEAIRSDKPFDKKLIKVLDELSI
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaataaagacaataggtattctgacctctggcggtgacgcccctggaatgaac
gcagcaatacgtgctgtgaccagagccggcatctataatggttttgaaatcaaaggtgtc
tatcgtggttatgagggattgattacggatgacattaagccttttaccactgagaatgtt
agcggtattatcggtcagggcggtacgatactcaagacggcacgctcaaaaggttttaaa
acgatggaaggacgtcagcaggcatacgataaccttgtcaaggagggtattgatgcgttg
gttgtcattggtggtaatggctcgttgacgggtgcgatgatgtttgcacaggagtttgat
ttctgttgcatcggtctgccgggtacgatagataatgacctctatggtacggacagcacc
atcggttatgacacgacgatgaacacaattatggagtgtgtcgaccgtattcgtgatacc
gctcagagccatgaacgcatcttctttgtagaagtaatgggacgtgatgctggtttcctt
gcacagaactcggctattgcgagtggtgcagaggcagcgattattccagaagactctact
aacgtcgaccagttgggtcgcttcatggaacgtggtattcgtaagtctaagagaagttgt
atcgttatcgtctctgagagccctaagtgtggagcgatgtattatgctgaccgtgtacgc
aaggagttccctgactatgacgtacgtgtgtcaattcttggccacttgcagcgtggtggt
cgcccttcagcacgcgaccgtatccttgcaagtagtacgggtgttggtgctattgaggcc
attatgcagggacaacgtaatattatggtaggtgtaagaaacaatgaggtggtttatgtt
cctttgtctgaggcaatccgttcagataagcctttcgacaagaaacttattaaggttctc
gacgagttgagtatttaa

DBGET integrated database retrieval system