KEGG   Prevotella melaninogenica: HMPREF0659_A6565Help
Entry
HMPREF0659_A6565  CDS       T01286                                 

Definition
cellulase (glycosyl hydrolase family 5)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pmz  Prevotella melaninogenica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pmz00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(193860..195074)
Genome map
AA seq 404 aa AA seqDB search
MKRNLLKICLLFVSMFTVFSCSASPSVVDTPDTSESIPTAKQWNKDVVGWNLGNEFECSA
PGQDGESMQIGNPDGSIHAETAWGNPVVTKKMIQAVKKAGFNAIRIPIRWQCHITNAQAM
SIDKAWIARIKEVVGWCLDNDLKVIINAHHEKWLEGRPTYQYKDENCQKLALLWMNIASE
FANYDSRLAFAGTNEVHVRDNWSKPTAENLEVQNAYNQIFVDMVRATGGNNAKRHLILQT
YVCNPWFGIENGGFVIPKDAEGNGNNYMSVEFHYYQPWSYAGDCAYDYWGDAYKDVGKIP
AENEKTMTDFFDKAMNTWSNKGLGIVIGEWGVTDHYKSNSVKVHENMTYYCKFLTTEARK
RGFSTFVWDNNHFGNGSEKYGIFDRFKSMKVNAPWILEGIFGKE
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggaaccttttgaaaatctgcttgctatttgtaagtatgtttactgtattttct
tgcagtgctagtccttcggtggtggatacgcctgatacaagcgaatcgattcctaccgcc
aagcaatggaacaaggatgtagtaggttggaatctcggcaatgaattcgagtgctcagct
cctggacaggatggagagtcgatgcagattggcaaccctgacggttccatccatgcagag
acagcttggggcaatcccgttgtcaccaaaaagatgatacaagccgtgaagaaggcaggt
ttcaatgccatccggattccaatccgttggcagtgccacattaccaatgctcaggcgatg
agcatcgacaaggcttggattgctcgtatcaaggaggtagtgggttggtgtctggataat
gacctcaaggttatcatcaatgcgcatcatgaaaaatggctcgaaggtcgtccgacctat
caatataaggatgaaaactgccaaaagcttgcgctcctctggatgaatatcgcctctgag
tttgccaattatgacagccgcttggctttcgccggtaccaatgaggttcacgtcagggac
aactggagcaagcctactgccgagaacctcgaagtgcagaatgcttacaatcagatattc
gtggatatggttcgtgccacaggcggcaacaatgccaagcgccacctcatcttacagact
tacgtttgcaacccttggtttggtatcgagaatggaggattcgtcattccgaaggatgcc
gaaggcaatggcaacaactatatgagtgtggaattccactactatcagccatggagctat
gccggcgattgcgcctacgattactggggtgatgcctacaaggatgttggcaagatacct
gctgaaaacgagaagacgatgacggatttcttcgataaggcaatgaatacatggagtaac
aaaggactgggtatcgtaataggagaatggggagtaaccgaccactataagtcaaactca
gtgaaagtgcatgaaaacatgacctactactgtaagttcttgactacggaggctcgcaaa
cgaggcttctctactttcgtttgggacaacaaccactttggcaacggctctgagaagtat
ggcatcttcgatcgtttcaagagtatgaaggtgaatgctccttggattctcgaaggaatc
tttgggaaagaataa

DBGET integrated database retrieval system