KEGG   Prevotella melaninogenica: HMPREF0659_A6687Help
Entry
HMPREF0659_A6687  CDS       T01286                                 

Definition
(GenBank) alpha amylase, catalytic domain protein
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pmz  Prevotella melaninogenica
Pathway
pmz00500  Starch and sucrose metabolism
pmz01100  Metabolic pathways
pmz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF0659_A6687
Enzymes [BR:pmz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     HMPREF0659_A6687
Exosome [BR:pmz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HMPREF0659_A6687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: ADK97148
UniProt: D9RVK5
Position
II:356919..359003
Genome map
AA seq 694 aa AA seqDB search
MVTKKTTTKKAPVKKTSAKTTKVKEPSHIGLVKNDAYLAPYEDAIRGRHEHALWKMNQLT
QNGKLTLSDFANGHNYYGLHRTADGWVFREWAPNATEIYLVGDFNGWNEQEAYQCHRIEG
TGNWELTLPHDAMQHGQYYKMRVHWEGGEGERIPAWTQRVVQDEASKIFSAQVWAPAEPY
VWKKKTFKPQTSPLLIYECHIGMAQDEEKVGTYNEFREKVLPRIIKDGYNAIQIMAIQEH
PYYGSFGYHVSSFFAASSRFGTPEELKALIDEAHKNGIAVIMDIVHSHAVKNEVEGLGNL
AGDPNQYFYPGERHEHPAWDSLCFDYGKDEVLHFLLSNCKYWLEEYHFDGFRFDGVTSML
YYSHGLGEAFCNYADYFNGHQDDNAICYLTLANCLIHEVNKNAVTIAEEVSGMPGLAAKF
KDGGYGFDYRMAMNIPDYWIKTIKELPDEAWKPSSIFWEIKNRRSDEKTISYCESHDQAL
VGDKTIIFRLVDADMYWHFRKGDETEMTHRGIALHKMIRLATIAAINGGYLNFMGNEFGH
PEWIDFPREGNGWSHKYARRQWNLVDNEELCYHLLGDFDRKMLEVITSEKKFNETPIQEI
WHNDGDQILAFSRGELVFVFNFSPSHSYSDYGFLVPEGSYNVVLNTDAREFGGFGFADDT
VEHFTNSDPLYEKDHKGWLKLYIPARSAVVLRKK
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atggttacaaagaagaccacaacaaagaaggctccagtcaaaaagacttctgctaaaacg
acaaaagtgaaggagccgtctcacataggactcgttaagaatgatgcctatttggctcct
tatgaggatgcaattcgtggacgtcacgagcatgctctttggaagatgaatcagcttact
cagaatggtaagttgacactctcggattttgcaaatggccataactactatggtttgcat
cggacagctgacggatgggtatttcgtgaatgggctcctaacgctactgagatttatctt
gttggtgatttcaatggttggaatgagcaagaagcctatcaatgtcacaggattgaaggt
actggtaactgggaacttacgctcccacatgatgctatgcagcatggtcagtactacaag
atgcgtgtacattgggaaggtggagaaggtgagcgcatccctgcttggacacaacgtgtt
gttcaagatgaagcaagcaaaatcttctctgcacaggtatgggcacctgctgagccatat
gtttggaagaaaaagacctttaagccacagacctctccactcctgatttatgagtgccac
attggtatggcacaggatgaggagaaggttggaacatataatgagttccgtgagaaggta
ttaccacgtataattaaggacggatataacgccattcagattatggctattcaggaacat
ccttattatggtagctttggttatcacgttagctctttctttgcagccagttcacgcttc
ggaacgcctgaagagttgaaggcactcattgatgaagcgcataagaatggcattgctgtt
atcatggatatcgtccactctcatgctgttaagaacgaggtggaaggcttgggcaactta
gctggtgatcctaatcaatacttctatccgggtgagcgtcatgagcatccagcatgggat
tcgctatgtttcgactatggtaaagacgaggttctccacttccttttgtctaactgtaaa
tactggttagaggaatatcactttgatggtttccgctttgatggtgtgacttcaatgctt
tattacagtcatggattaggtgaagcattctgcaactatgctgattatttcaatggtcat
caggatgataacgctatctgttatttgacacttgccaactgtcttatccatgaggtaaac
aagaatgcagtaacgattgcagaggaagtgtcgggtatgccaggtttagcagctaagttt
aaagatggtggatacggctttgattatcgtatggcaatgaatattccagactactggata
aagactatcaaggaattaccagacgaggcttggaagccatcttctatcttctgggagata
aagaatcgacgttctgatgagaaaactatttcttattgcgaatcacacgaccaagcgttg
gtgggcgataagactattatcttccggttagtagatgcagatatgtattggcatttccgt
aagggagacgaaacagagatgactcatcgtggcattgcactgcataagatgattcgtctt
gccactattgctgctattaatggtggctatctgaacttcatgggtaatgagtttggtcat
ccagagtggattgattttccacgtgaaggaaatggatggagccataagtatgcccgtcga
cagtggaacttggttgataatgaggaattatgctatcacttgcttggcgacttcgaccgt
aagatgttggaggtaattacaagtgagaagaagtttaatgagactcctatccaagagatt
tggcacaatgatggcgaccagatattggcatttagtaggggagagttagtctttgtattt
aacttctcaccatcacattcttattctgattatggtttcttggtgccagagggatcttat
aatgtagtattaaacacagatgccagagagtttggtggctttggctttgctgatgataca
gtagagcatttcacaaatagcgaccctctttatgagaaagatcataaaggctggctcaaa
ctttatataccagctcgtagtgctgtagtattgagaaagaaataa

DBGET integrated database retrieval system