KEGG   Prevotella melaninogenica: HMPREF0659_A6761Help
Entry
HMPREF0659_A6761  CDS       T01286                                 

Gene name
ispE
Definition
(GenBank) 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pmz  Prevotella melaninogenica
Pathway
pmz00900  Terpenoid backbone biosynthesis
pmz01100  Metabolic pathways
pmz01110  Biosynthesis of secondary metabolites
pmz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pmz00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HMPREF0659_A6761 (ispE)
Enzymes [BR:pmz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HMPREF0659_A6761 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ADK96645
UniProt: D9RVS9
Position
II:453406..454245
Genome map
AA seq 279 aa AA seqDB search
MITFPCCKINLGLNIVAKRPDGYHDLETVFYPVPLCDVLEIKKMDEEFPSPTPIDLKVTG
HAVECDERNNLVVKAYHLLAKDYELPRIHVHLVKRIPMQAGLGGGSADAAYMIRLLDERF
RLNMGNAEMERYAAQLGADCAFFIRSEIAYATGIGDVLAPADNEHHSLEGYYLALVKPDV
AVSTAEAYAGVTPKKPAKSCRDIVRQPIDTWRDELTNDFEKSLFAKYPVLADVKEKLYAN
GALYAQMSGSGSTIFGIFGQKPANIKEFFPGMFTYCVRL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgattacctttccttgctgtaaaatcaaccttggattaaatattgttgcaaaacgtcct
gatggctatcatgaccttgaaacagttttttatcctgttcctttatgtgatgtgttggaa
attaaaaagatggatgaggagtttccctctcctactcccatagacttaaaagtgactggt
catgctgtagaatgtgatgagcgtaataatttggtagttaaggcttatcatctccttgca
aaggattatgagttacctcgcatacatgttcaccttgttaagcgtattcctatgcaggca
ggacttggaggtggttcagctgatgctgcttatatgattcgattgctcgatgagcgtttt
cgtttgaatatgggtaatgcagagatggagcgttatgcagcccaattgggtgccgattgt
gcgttctttattcgttctgaaatagcctatgcaacgggaataggtgatgttcttgcacct
gcagataacgaacatcatagtttagaaggatattatcttgcattggtaaagcctgatgta
gctgtctctactgccgaagcctatgctggagtgacacccaagaaacctgcgaaaagctgt
cgtgatatagttcgccaaccaattgatacatggcgtgatgagcttacaaatgattttgaa
aaatctctttttgcaaaatatcctgtgttggctgatgttaaagaaaaactatatgcgaat
ggtgctttgtatgcacagatgtcaggtagtggtagtactatctttggtatctttggtcaa
aagccagcgaatataaaggaatttttcccaggaatgttcacatattgtgtcagactctaa

DBGET integrated database retrieval system