KEGG   Prevotella melaninogenica: HMPREF0659_A6901Help
Entry
HMPREF0659_A6901  CDS       T01286                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pmz  Prevotella melaninogenica
Pathway
pmz00480  Glutathione metabolism
pmz00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pmz00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    HMPREF0659_A6901
  Metabolism of other amino acids
   00480 Glutathione metabolism
    HMPREF0659_A6901
Enzymes [BR:pmz01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     HMPREF0659_A6901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ADK97115
UniProt: D9RW66
Position
II:639945..640493
Genome map
AA seq 182 aa AA seqDB search
MRTVYEFSVKDRKGKAFSLKEFSNEVLLIVNTATKCGFTPTYEELEALYEKYHAQGFEVL
DFPCNQFGQQAPGTDESIHEFCKLTYGTKFPRFKKVKVNGEDADPLFKFLKEQKGFAGWD
ESHKLYPILDKMLSEADPNYKENPDIKWNFTKFLINKKGQVVARFEPTESIENIAKQIEE
LL
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgagaacagtttatgaattctctgtcaaagacagaaaaggtaaggcattttcactgaaa
gagttttctaatgaggtgctactgattgtaaacacagctacaaaatgtggtttcacacca
acttacgaggagttggaggcactctatgagaagtaccatgcacaaggatttgaagtactt
gatttcccttgcaaccagtttggacagcaggcaccaggtacagacgaaagcatccatgag
ttctgcaaacttacatacggcacaaaattcccacgcttcaagaaggtaaaggtgaacggt
gaagacgctgacccactcttcaagttcctcaaggagcagaagggctttgctggttgggat
gagtcacataagctctaccctatcctcgacaagatgctttctgaggctgatcctaactat
aaggagaatccagatattaagtggaacttcaccaagttccttattaataagaagggacag
gtcgttgctcgctttgaaccaacagagagcattgagaatatcgcaaagcagattgaagaa
ttactgtag

DBGET integrated database retrieval system