KEGG   Prevotella melaninogenica: HMPREF0659_A6903Help
Entry
HMPREF0659_A6903  CDS       T01286                                 

Definition
pyridoxal-phosphate dependent TrpB-like enzyme
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pmz  Prevotella melaninogenica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF0659_A6903
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0659_A6903
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF0659_A6903
Enzymes [BR:pmz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HMPREF0659_A6903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:642381..643742
Genome map
AA seq 453 aa AA seqDB search
MAQQKRFILDEKDIPTQWYNIQADMPTKPLPPLHPATRKPMTAEDLSEIFSQECAKQELD
CEHAWIDIPEEVLEMYKYYRSTPLVRAYALEKALDTPAHIYFKNESVNPLGSHKVNSAIP
QCYYCKKEGVTNVTTETGAGQWGAALSYAAKVYGLEAAVYQVKISMQQKPYRSLIMKTFG
AMVEGSPSMSTRAGKDIVTRDPTHPGSLGAAISEAIELAKTTPNCKYTLGSVLNHVALHQ
TIIGLEAEKQMEMAGEYPDKVIACFGGGSNFGGIAFPFMRHNILEGKNTEFIAAEPNSCP
KLTRGRFEYDFGDEAGYTPLLPMFTLGHDFKPANIHAGGLRYHGAGVIVSQLLKDGYMCG
MDIPQLESFEAGILFSRTEGIIPAPESCHAIAAAIREAKKAKETGKEDVILFCLSGHGLI
DMTAYDTYINGDLRNYTLSDDEIEKNLGIVPKV
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggcacaacagaaaagatttatacttgacgagaaagatatccctacacagtggtataat
attcaggcagacatgcccactaagccccttcctccacttcatccagctacacgtaagcca
atgacagcagaggatctttcggagattttcagtcaagaatgtgcaaaacaagagcttgat
tgtgagcatgcttggattgatattcccgaagaagtgttggagatgtataagtattatcgc
tccacacctcttgtccgtgcgtatgctttggagaaagcattagacacaccagcacatatc
tatttcaagaatgaaagtgtaaatccacttggctcacataaggttaattctgccatccct
cagtgttactattgcaagaaggaaggtgtaacgaatgtcacgacagagactggtgcgggt
caatggggcgctgcactatcctacgctgcaaaggtatatggtcttgaagcagcggtttat
caggtaaagatttctatgcaacagaaaccttatcgctcgctgattatgaagactttcgga
gctatggttgaaggttcaccttcaatgtctacacgtgcaggaaaggacatcgttacacga
gacccaacacatcctggttcgttgggagcagcaatctcagaggctatagaactggcaaaa
actacacctaactgtaagtacactttaggttcagtactcaatcacgttgcattgcaccaa
accattattggtttggaggctgagaagcaaatggaaatggctggggaatatcctgataag
gtcattgcttgctttggtggtggtagtaattttggtggtattgcattcccatttatgcgc
cacaatatccttgaaggaaagaatacagagtttatcgcagcagagccaaatagctgtcca
aaactgacacgtggcaggtttgaatacgacttcggtgacgaagcgggttacactcctttg
ctaccaatgttcacacttggccatgatttcaaaccagccaatatccatgcaggtggttta
cgctatcatggtgctggtgtcatcgtcagtcaattgctcaaagacggatacatgtgtgga
atggacataccacagttagaaagctttgaggcaggtatcctcttctctcgcacagaagga
attatccccgcaccagagagctgtcatgccattgcagctgccattcgagaagcaaagaag
gcaaaggaaacaggaaaagaagatgttattctcttctgtctttctggtcatggactcatt
gatatgacggcttatgacacctatatcaatggtgatttaagaaactatacactctctgat
gacgagatagagaagaaccttgggattgttccgaaggtatag

DBGET integrated database retrieval system