KEGG   Prevotella melaninogenica: HMPREF0659_A6903Help
Entry
HMPREF0659_A6903  CDS       T01286                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pmz  Prevotella melaninogenica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF0659_A6903
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0659_A6903
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF0659_A6903
Enzymes [BR:pmz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HMPREF0659_A6903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
II:642381..643742
Genome map
AA seq 453 aa AA seqDB search
MAQQKRFILDEKDIPTQWYNIQADMPTKPLPPLHPATRKPMTAEDLSEIFSQECAKQELD
CEHAWIDIPEEVLEMYKYYRSTPLVRAYALEKALDTPAHIYFKNESVNPLGSHKVNSAIP
QCYYCKKEGVTNVTTETGAGQWGAALSYAAKVYGLEAAVYQVKISMQQKPYRSLIMKTFG
AMVEGSPSMSTRAGKDIVTRDPTHPGSLGAAISEAIELAKTTPNCKYTLGSVLNHVALHQ
TIIGLEAEKQMEMAGEYPDKVIACFGGGSNFGGIAFPFMRHNILEGKNTEFIAAEPNSCP
KLTRGRFEYDFGDEAGYTPLLPMFTLGHDFKPANIHAGGLRYHGAGVIVSQLLKDGYMCG
MDIPQLESFEAGILFSRTEGIIPAPESCHAIAAAIREAKKAKETGKEDVILFCLSGHGLI
DMTAYDTYINGDLRNYTLSDDEIEKNLGIVPKV
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggcacaacagaaaagatttatacttgacgagaaagatatccctacacagtggtataat
attcaggcagacatgcccactaagccccttcctccacttcatccagctacacgtaagcca
atgacagcagaggatctttcggagattttcagtcaagaatgtgcaaaacaagagcttgat
tgtgagcatgcttggattgatattcccgaagaagtgttggagatgtataagtattatcgc
tccacacctcttgtccgtgcgtatgctttggagaaagcattagacacaccagcacatatc
tatttcaagaatgaaagtgtaaatccacttggctcacataaggttaattctgccatccct
cagtgttactattgcaagaaggaaggtgtaacgaatgtcacgacagagactggtgcgggt
caatggggcgctgcactatcctacgctgcaaaggtatatggtcttgaagcagcggtttat
caggtaaagatttctatgcaacagaaaccttatcgctcgctgattatgaagactttcgga
gctatggttgaaggttcaccttcaatgtctacacgtgcaggaaaggacatcgttacacga
gacccaacacatcctggttcgttgggagcagcaatctcagaggctatagaactggcaaaa
actacacctaactgtaagtacactttaggttcagtactcaatcacgttgcattgcaccaa
accattattggtttggaggctgagaagcaaatggaaatggctggggaatatcctgataag
gtcattgcttgctttggtggtggtagtaattttggtggtattgcattcccatttatgcgc
cacaatatccttgaaggaaagaatacagagtttatcgcagcagagccaaatagctgtcca
aaactgacacgtggcaggtttgaatacgacttcggtgacgaagcgggttacactcctttg
ctaccaatgttcacacttggccatgatttcaaaccagccaatatccatgcaggtggttta
cgctatcatggtgctggtgtcatcgtcagtcaattgctcaaagacggatacatgtgtgga
atggacataccacagttagaaagctttgaggcaggtatcctcttctctcgcacagaagga
attatccccgcaccagagagctgtcatgccattgcagctgccattcgagaagcaaagaag
gcaaaggaaacaggaaaagaagatgttattctcttctgtctttctggtcatggactcatt
gatatgacggcttatgacacctatatcaatggtgatttaagaaactatacactctctgat
gacgagatagagaagaaccttgggattgttccgaaggtatag

DBGET integrated database retrieval system