KEGG   Prevotella melaninogenica: HMPREF0659_A6903Help
Entry
HMPREF0659_A6903  CDS       T01286                                 

Definition
pyridoxal-phosphate dependent TrpB-like enzyme
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pmz  Prevotella melaninogenica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pmz01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pmz00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pmz00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:642381..643742
Genome map
AA seq 453 aa AA seqDB search
MAQQKRFILDEKDIPTQWYNIQADMPTKPLPPLHPATRKPMTAEDLSEIFSQECAKQELD
CEHAWIDIPEEVLEMYKYYRSTPLVRAYALEKALDTPAHIYFKNESVNPLGSHKVNSAIP
QCYYCKKEGVTNVTTETGAGQWGAALSYAAKVYGLEAAVYQVKISMQQKPYRSLIMKTFG
AMVEGSPSMSTRAGKDIVTRDPTHPGSLGAAISEAIELAKTTPNCKYTLGSVLNHVALHQ
TIIGLEAEKQMEMAGEYPDKVIACFGGGSNFGGIAFPFMRHNILEGKNTEFIAAEPNSCP
KLTRGRFEYDFGDEAGYTPLLPMFTLGHDFKPANIHAGGLRYHGAGVIVSQLLKDGYMCG
MDIPQLESFEAGILFSRTEGIIPAPESCHAIAAAIREAKKAKETGKEDVILFCLSGHGLI
DMTAYDTYINGDLRNYTLSDDEIEKNLGIVPKV
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggcacaacagaaaagatttatacttgacgagaaagatatccctacacagtggtataat
attcaggcagacatgcccactaagccccttcctccacttcatccagctacacgtaagcca
atgacagcagaggatctttcggagattttcagtcaagaatgtgcaaaacaagagcttgat
tgtgagcatgcttggattgatattcccgaagaagtgttggagatgtataagtattatcgc
tccacacctcttgtccgtgcgtatgctttggagaaagcattagacacaccagcacatatc
tatttcaagaatgaaagtgtaaatccacttggctcacataaggttaattctgccatccct
cagtgttactattgcaagaaggaaggtgtaacgaatgtcacgacagagactggtgcgggt
caatggggcgctgcactatcctacgctgcaaaggtatatggtcttgaagcagcggtttat
caggtaaagatttctatgcaacagaaaccttatcgctcgctgattatgaagactttcgga
gctatggttgaaggttcaccttcaatgtctacacgtgcaggaaaggacatcgttacacga
gacccaacacatcctggttcgttgggagcagcaatctcagaggctatagaactggcaaaa
actacacctaactgtaagtacactttaggttcagtactcaatcacgttgcattgcaccaa
accattattggtttggaggctgagaagcaaatggaaatggctggggaatatcctgataag
gtcattgcttgctttggtggtggtagtaattttggtggtattgcattcccatttatgcgc
cacaatatccttgaaggaaagaatacagagtttatcgcagcagagccaaatagctgtcca
aaactgacacgtggcaggtttgaatacgacttcggtgacgaagcgggttacactcctttg
ctaccaatgttcacacttggccatgatttcaaaccagccaatatccatgcaggtggttta
cgctatcatggtgctggtgtcatcgtcagtcaattgctcaaagacggatacatgtgtgga
atggacataccacagttagaaagctttgaggcaggtatcctcttctctcgcacagaagga
attatccccgcaccagagagctgtcatgccattgcagctgccattcgagaagcaaagaag
gcaaaggaaacaggaaaagaagatgttattctcttctgtctttctggtcatggactcatt
gatatgacggcttatgacacctatatcaatggtgatttaagaaactatacactctctgat
gacgagatagagaagaaccttgggattgttccgaaggtatag

DBGET integrated database retrieval system