KEGG   Prevotella melaninogenica: HMPREF0659_A7194Help
Entry
HMPREF0659_A7194  CDS       T01286                                 

Definition
beta-L-N-acetylhexosaminidase family protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
pmz  Prevotella melaninogenica
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmz00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF0659_A7194
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    HMPREF0659_A7194
Enzymes [BR:pmz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     HMPREF0659_A7194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:1053882..1055492
Genome map
AA seq 536 aa AA seqDB search
MKKILLSVALMMATFSLHATDANYQVVPLPQSITAEKGTPFVLDANTVINVASNDEAMRR
NGEFLKQYIQEATGIALNGMNKKGSTITLKLNAKVENEEGYVITVKGKNIIVEGKTPRGV
FYGVQTLRKSLPLEKAENVTFPAARIVDYPRFGYRGTMLDCARHYFKMSFIKEFIDMLAL
HNVNTFHWHLTEDQGWRAQIDRYPKLTEVGSKRAQTVIGRMTGLFDETPYGGYYTKDEMR
EVVKYAADRYITVIPEIDMPGHMLGALAAYPELGCTGGPYKVAEQWGVFPDILCAGNPKT
YEFVNNVLDEIVDIFPSKYIHIGGDEAPRDRWKTCPRCQAEIKRLGLKGSNGFPAEAQLQ
AYFMNQAAKHLAEKGRNIIGWDEILEGDVDKGTTVMSWRGVNGGIEAAKRGLDAIMTPVN
YYYLDYYQRKDNTMTLIGGFLPVETTYGYNPVPDDAAPELKKHVKGVQANLWTEYVIGRD
LAFFQLLPRVAAMAETGWTENDKKDFASFKARETRLNELYKHFGWKTCQDLYKEKK
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatcttactttcagtggcattgatgatggctacattctcacttcatgccaca
gatgcgaactatcaagtagttcctctcccacagagtattactgctgagaagggtacacca
ttcgttttggatgctaacaccgttattaatgttgcaagcaacgatgaggctatgcgccgt
aatggtgaattcttgaagcaatatatccaagaggcaactggtattgcgctcaatggtatg
aacaagaaaggaagtactattaccttgaaactcaatgcaaaggttgagaatgaggagggt
tatgttatcaccgtaaagggtaagaatattatcgttgagggtaagactccacgtggtgta
ttctatggtgtacagacccttcgcaagtcattaccattggagaaggcagagaacgtaacc
ttcccagcagctcgtatcgttgactatccacgcttcggctatcgtggtacgatgctcgat
tgcgctcgtcactatttcaagatgagtttcatcaaggagtttatcgatatgttggcactt
cacaatgtcaacaccttccactggcatctcactgaggatcagggctggcgtgcacagatt
gaccgctatccaaagctcactgaggttggttcaaagcgtgcgcagacagttattggtcgt
atgacaggactctttgatgagaccccatacggtggttattatacaaaggatgagatgcgt
gaagttgtgaagtatgcagctgatcgttatatcactgttattccagagattgatatgcca
ggccacatgctcggcgcattggcagcttacccagagcttggttgtactggtggtccttac
aaagtggctgagcaatggggcgtattcccagacattctctgtgctggtaaccctaagacc
tacgagtttgtgaacaatgttctcgatgagattgttgatatcttcccatcaaaatatatc
cacatcggtggtgatgaggctccacgtgatcgttggaagacctgtccacgctgtcaggct
gaaatcaaacgtctcggcttgaagggctctaacggcttccctgcagaggctcagttgcag
gcttacttcatgaatcaggctgctaagcacttggctgaaaaaggtcgtaacatcatcggt
tgggacgagattcttgagggtgatgtagacaagggtacaactgtcatgagctggcgtggt
gtgaatggtggtatcgaggcggctaagcgtggcctggatgccatcatgactccagtaaac
tattactatctcgactactatcagagaaaggataacacgatgaccctcatcggtggtttc
ctcccagttgagacaacttacggctacaacccagtgccagacgacgctgcacctgagttg
aagaaacacgttaagggtgtacaggcaaacctctggactgagtatgttatcggtcgcgac
ctcgctttcttccagctcctcccacgtgttgctgctatggcagagactggttggacagag
aacgataagaaggacttcgcttctttcaaggcacgtgaaacccgcctgaacgagctttac
aagcacttcggttggaagacttgccaggacctctacaaggagaagaagtaa

DBGET integrated database retrieval system