KEGG   Prevotella melaninogenica: HMPREF0659_A7398Help
Entry
HMPREF0659_A7398  CDS       T01286                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pmz  Prevotella melaninogenica
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pmz03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1359075..1359683)
Genome map
AA seq 202 aa AA seqDB search
MQQYPSQLLERAVEAFSQLPGVGRKTALRLVLHLLRQSTEDVDSFADAVIRVKHDVKYCK
VCHNISDNEVCSICSDPRRDASVVCVVENIQDVMAIENTQQFHGLYHVLGGIISPMDGIG
PHDLEIESLVERVEEGTVKEIILALASTMEGDTTNFYISRKLKDTGVKLSVIARGISVGD
ELEYTDEVTLGRSILNRTPFES
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaatacccttctcaactcttagaacgtgccgtagaggctttctcacagttgcca
ggtgtggggcgcaagaccgctctgcgccttgttttgcatctgctacgccagtcgactgag
gacgtggatagctttgcggatgctgttatacgtgtgaaacacgatgtgaagtattgcaag
gtttgccataatatttccgataacgaggtttgttctatctgttctgacccacgccgtgat
gcgtcagtggtctgtgtggtagagaacattcaggacgtgatggcgattgagaatacccag
cagttccatggattataccacgttttggggggtattatctctccgatggacggtatcgga
ccgcacgacttagagattgaatcgctcgtagagcgcgtggaagagggtacggtgaaggaa
atcatccttgcccttgccagtacgatggagggcgacacaaccaacttttatatctcacgc
aagctgaaagacacaggcgtgaaactgtcggttatcgcacgaggtatctctgttggcgac
gaacttgaatatacagatgaggtgacgttgggcagaagtattctgaaccgcacacctttt
gaatcttaa

DBGET integrated database retrieval system