KEGG   Polaromonas naphthalenivorans: Pnap_0049Help
Entry
Pnap_0049         CDS       T00459                                 

Definition
(GenBank) phenylacetaldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00030  Pentose phosphate pathway
pna01100  Metabolic pathways
pna01120  Microbial metabolism in diverse environments
pna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Pnap_0049
Enzymes [BR:pna01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Pnap_0049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ABM35375
UniProt: A1VI97
Position
48852..50699
Genome map
AA seq 615 aa AA seqDB search
MSWAGKILRVNLSAGTVAAEPLNMDWAHSYLGSRGLGSKYLVSEVDPKVDPLSPENKIIW
ATGPLTGTMASTGGRYTVITKSPLTGAIACSNSGGYWGAELKMAGWDMVIFEGKSPTPVY
LYINDDTAELRDAAHLWGKSVWETEPLIKQSLQDPLIRVSCIGKAGENGVLYAAVINDLH
RAAGRSGVGAVMGSKNLKAIAVRGTKGVGNLRDPKAFMKVTYEKKKILRDNAVTGQGLPT
FGTQVLMNVINEVGALPTRNHQDVQFEGAKDISAEAMATPRATDGKAQLITNQACFGCTI
ACGRISKMDAGHFTVSNKPQYWGASGGLEYEAAWALGAANGVKDLEALQYATMLCNEEGI
DPISFGATLGAVMELYEMGVLSKEQLGIEAPFGSAAALAFLAEETVHSRGFGKEIGQGSK
RLTAKYGHPDLSMSSKGQEFPAYDGRAIQGIGLAYATSNRGGCHLRGYTVASEVLGIPVK
TDPLEHEGKPELVKAFQDATAVFDSAGICVFTSFAWGLADVAPQLQAACGEQYTTEELEK
IGERIWNMEREFNNAAGFTKADDSLPKRLLTEAAKTGPAKGKVNMLAEMLPKYYAARGWD
SEGVPTAATRERLGL
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgtcctgggctggaaaaatcctccgcgtcaacctgagcgccggcaccgtcgccgccgag
ccgctcaacatggattgggcgcacagctacctgggctcgcgcgggctgggcagcaaatac
ctggtgtccgaggtcgatcccaaggtcgatccgctgtcgccggagaacaagatcatctgg
gccaccgggccgctcacgggcaccatggcctcgaccggcgggcgctacaccgtcatcacc
aagagcccgctgaccggcgccattgcctgctccaattcgggcggctactggggcgccgag
ctgaagatggcgggctgggacatggtgatctttgaaggcaaatcgcccacgccggtctac
ctctacatcaacgacgacacggccgagctgcgcgatgccgcccacctctggggcaagagc
gtctgggagaccgagccgctgatcaagcagagcctgcaggaccccttgatacgcgtttcc
tgcatcggcaaggcgggtgaaaacggcgtgctgtatgccgccgtgatcaacgacctgcac
cgcgccgccggccgctcgggcgtgggtgccgtgatgggcagcaagaacctcaaggcgata
gcggtgcgcggcaccaagggcgtgggcaatctgcgcgaccccaaggccttcatgaaggtc
acctacgagaagaaaaaaatcctgcgcgacaacgccgtcaccggccagggcctgccgacc
ttcggcacgcaggtgctgatgaacgtgatcaatgaagtcggcgcgctgcccacccgcaac
caccaggatgtgcagttcgagggcgccaaggacatttcggccgaagccatggccacgccg
cgcgccaccgacggcaaggcgcaactgatcaccaaccaggcctgcttcggctgcacgatt
gcctgcgggcgcatcagcaagatggacgccggccatttcaccgtgtcgaacaagccgcag
tactggggcgcgtcgggcgggctcgaatacgaagccgcctgggcgctgggcgcggccaat
ggcgtgaaagacctggaagcgctgcagtacgccaccatgctgtgcaacgaggaaggcatc
gacccgatcagctttggcgccaccctgggcgcggtgatggaactctacgaaatgggcgtg
ctgagcaaggagcagctcggcatcgaggcgccgttcggctcggcggcggcattggccttt
ctggccgaggaaacggtgcacagccggggcttcggcaaggaaatcggccagggctccaag
cgcctgacggccaaatacggccatcccgacctgtcgatgtcgtccaagggccaggagttc
ccggcctacgacggccgcgccatccagggcatcgggctggcctatgccacgtccaaccgg
ggcggctgccatttgcgcggctacaccgttgcctccgaagtgctgggcatcccggtcaag
accgatccgctggagcacgagggcaagcccgagctggtcaaggccttccaggacgcgacg
gcggtcttcgactccgccgggatttgcgtgttcacctccttcgcctggggcctggccgat
gttgcgccccagctgcaggccgcctgcggcgagcagtacacgaccgaggaactggaaaaa
atcggcgagcgcatctggaacatggagcgcgagttcaacaacgccgccggtttcaccaag
gccgacgattcattgcccaagcgcctgctgacggaggcggccaagaccggcccggccaag
ggcaaggtcaacatgctggccgaaatgctgcccaagtactatgccgcgcgcggctgggac
agcgaaggcgtgccgacggccgcgacccgcgagcgcctcggcctttaa

DBGET integrated database retrieval system