KEGG   Polaromonas naphthalenivorans: Pnap_0232Help
Entry
Pnap_0232         CDS       T00459                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
pna  Polaromonas naphthalenivorans
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pnap_0232
Enzymes [BR:pna01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Pnap_0232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
238956..240437
Genome map
AA seq 493 aa AA seqDB search
MKNEVQLITYADRLSGGTLQDLRALLNGPLAGVFGAVHILPFFYSIHGADAGFDPIDHTR
VDPALGDWSDIKALAQDMDVMADVIVNHMSSDSPQFIDYSKRGAASPYNGLFLTFDAVFP
EGATEEDLISVYRPRPGLPFTCMTLANGEKKILWTTFTPKQLDIDVQHPQGRSYLESILQ
ALASSGVKMIRLDAVGYAIKKQGDSCFLMPETFDFIDEFAALCRSVGLEVLVEVHSYYRK
QIEIAKRVDWVYDFALPPLVLHAFFFKTGKHLKQWIAQRPTNALTVLDTHDGIGIIDIGA
DPSDRVNRPGLVPPQELDRLVEIIHINSGGQSREATGAAASNLDLYQVNCTFYDAMGRDD
TAYLLARAIQFFMPGIPQVYYVGLLAGRNDMDLLERTRVGRDINRHRYASAEVDSALGRP
VVQQLLELIRLRNAHPAFDGAFSVEPTGDSCLHMRWINGPVVAELLVDFTDLRHELLFTD
EGGTRRIAFAKAF
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgaagtccaactcatcacctatgccgaccgcttgagcggcggaacccttcag
gatctacgtgcgcttttgaacggcccgctggccggtgttttcggcgctgttcatatcctg
ccgttcttctactcgatccatggtgcggatgccgggttcgaccccatagaccacacccgc
gtggaccccgccctgggcgactggagcgacatcaaggccctggcgcaggacatggatgtg
atggccgatgtgatcgtcaaccacatgtcgtcagactccccgcagttcatcgactattcg
aaacgtggcgcggcgtcgccctacaacggtcttttcctgacttttgacgctgttttccct
gaaggcgccaccgaggaagatctgatatccgtgtatcggccgcgtccaggcttgcccttt
acctgcatgacgctggccaatggcgaaaaaaaaattctctggacaacattcacgcccaag
caactggacattgatgtgcagcatccgcaaggccgcagctatcttgagtcaatcttgcag
gcactggcttccagtggcgtgaagatgatccggctggacgctgtgggctatgcgatcaag
aagcagggcgacagctgcttcttgatgcccgagactttcgacttcatcgacgagttcgct
gcactgtgccgctcggtggggcttgaggttctggtcgaggtgcattcctactatcgcaaa
cagatcgagatcgccaaacgcgttgactgggtgtacgacttcgctctgcctccactggtg
ctccacgcgtttttcttcaagacaggaaagcacctcaagcaatggattgcccagcggccg
accaacgcattgacggtactcgacacacacgacgggatcggcatcatcgatataggcgct
gatccgtctgatcgcgtgaacagacccggcctggtaccgccccaggaactcgaccggttg
gtggaaatcatccacatcaacagcggcggccagagccgcgaagcaacgggcgcagctgcg
tccaatctcgacctttatcaggtcaattgcactttttatgacgcgatgggccgcgatgac
acggcctacctgttggctcgtgcgatccagttcttcatgccgggcattccgcaggtctat
tacgtcggattgctggcgggcaggaatgacatggacttgcttgagcgtacccgcgtgggt
cgggatatcaaccggcaccgttacgcgagcgctgaggtcgattcagcgctcgggcggcca
gtcgtacagcaactcctcgagttgatccggctacgtaatgcgcatcccgcgttcgacggc
gcgttcagtgtcgagccaaccggcgacagctgcctgcacatgcggtggatcaacgggcct
gtggtggctgagctgctcgtcgatttcaccgaccttcgccatgaactcctgttcacggat
gagggcgggacgaggcggattgcttttgccaaggcgttttaa

DBGET integrated database retrieval system