KEGG   Polaromonas naphthalenivorans: Pnap_0328Help
Entry
Pnap_0328         CDS       T00459                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pna  Polaromonas naphthalenivorans
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Pnap_0328
Enzymes [BR:pna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Pnap_0328
Exosome [BR:pna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pnap_0328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(330919..332412)
Genome map
AA seq 497 aa AA seqDB search
MAYLLALDQGTSSSRSIVFDEEGRVVALAQRELPQIYPRPGWVEHDPMEIWRGQLATARQ
ALASVGLAAWDIRAMGITNQRETTVLWNRRTGQPVHHAIVWQDRRAESTCAQLREQGHEA
LIQAKTGLLIDAYFSGTKLKWLLDNVAGVRAQAERGELAFGTIDSWLIWQLTGGTVHATD
VSNASRTMLFNVRTNQWDAELLDLLGIPASLMPEVKPSSAHYGEVRPELLGHAIPIGGVA
GDQQSALFGQACFRAGMAKNTYGTGCFLLMHTGAQFQASKNGLLTTSAAQTTAQTEFALE
GSVFVGGAVVQWLRDGLHAIQGSAEVEALAQSVPDSGGVMMVPAFTGLGAPYWKPEARGT
ITGLTRGTTMAHIARAALESIAYQSAALLLAMSRDAVAAGAAPLAELRVDGGASSNDLLM
QFQADLLGIPVIRPAVTETTALGAAWLAGLSSGVYGSTDELSSLWRAERTFLPTLSTGRA
AELMAQWEHAVRQTVLA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggcctatcttctcgccctcgatcagggaacctccagttcgcgaagcattgtgtttgac
gaagaaggccgcgtggtggcgctggcccagcgggagttgccgcagatttatcccaggccg
ggctgggtcgagcacgacccgatggaaatctggcgcggccagctggccacggcgcggcag
gcgctggccagcgtgggcctggccgcctgggacatccgggcgatgggcatcaccaaccag
cgcgaaaccacggtgctctggaaccgcaggaccggccagccggttcaccatgccatcgtc
tggcaggaccggcgcgccgagtccacctgcgcgcaattgcgcgagcaaggccatgaagcg
ctgattcaagccaagacagggctgctcatcgacgcctatttttcaggcaccaagctcaag
tggctgctcgacaacgtagccggtgtgcgcgcgcaggccgagcgcggcgaactggccttt
ggcaccatcgacagctggctgatctggcagctgacgggcggcaccgtgcatgccaccgac
gtcagcaatgcctcgcgaacgatgctgttcaatgtgcgtaccaaccagtgggatgccgaa
ctgctggacctgctgggcattccggcgtcgctgatgcccgaggtgaagccgtccagcgcg
cactacggcgaggtgcggcccgagctgctgggccatgctatcccgattggtggcgtcgcg
ggcgaccagcaaagcgcgctgttcggccaggcctgcttcagggccggcatggccaagaac
acctacggcaccggctgcttcctgctgatgcacaccggcgcgcagttccaggcgtcgaag
aacggcctgctgaccaccagcgccgcccaaaccacggcgcagaccgaattcgccctggaa
ggcagcgtattcgtcggcggcgcggtggtgcagtggctgcgcgacggcctgcacgccatc
cagggcagcgccgaggtcgaggcgctggcgcaaagcgttcccgactcgggcggcgtgatg
atggtgccggccttcaccggcctgggcgcgccctactggaaacccgaggcgcgcggcacc
atcaccggcctgacgcgcggcacgaccatggcccacattgcgcgcgcggcgctggaaagc
atcgcctaccagagcgccgcgctgctgctggccatgagccgcgatgctgtcgccgcaggc
gccgcgccgctggccgagttgcgcgtcgatggcggcgccagcagcaacgacctcctgatg
caattccaggccgacctgctgggcattccggtgatccgcccggccgtgaccgaaaccacg
gcgctgggtgcggcctggctggcgggcctgtccagcggcgtgtacggcagtaccgacgag
ctttccagcctgtggcgcgctgaacgcaccttcctgcccacgctcagcaccgggcgcgca
gccgaactgatggcgcaatgggagcatgcggtgcggcagacggtgctggcgtag

DBGET integrated database retrieval system