KEGG   Polaromonas naphthalenivorans: Pnap_0336Help
Entry
Pnap_0336         CDS       T00459                                 

Definition
(GenBank) LSU ribosomal protein L18P
  KO
K02881  
large subunit ribosomal protein L18
Organism
pna  Polaromonas naphthalenivorans
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:pna00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Pnap_0336
Ribosome [BR:pna03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    Pnap_0336
  Bacteria
    Pnap_0336
  Archaea
    Pnap_0336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
336956..337321
Genome map
AA seq 121 aa AA seqDB search
MLTKKEQRLRRSRQTRIRIANQGVARLSVNRTNLHIYASVISGDGTKVLASASTAEVEVR
NEIGGSGKGGNVAAAQAIGKRIAEKAKAAGVEKVAFDRAGFAYHGRVKALADAAREAGLQ
F
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgttgaccaaaaaagagcagcgccttcgtcgttcacgccagacccgcatccgcattgcc
aatcaaggcgttgcccgtctgtccgtgaatcgcaccaatctgcatatttacgccagtgtt
atttctggcgacggcaccaaggttctggcgtctgcttccactgctgaagtggaagtgcgc
aatgaaattggcggctcgggcaagggtggaaatgttgctgctgcgcaggccattggcaag
cgtattgccgaaaaggcaaaagcagcaggtgtagaaaaagtggcgtttgatcgcgccggt
tttgcgtaccatggccgcgtcaaagcgctggctgatgcggctcgcgaagccggtttgcag
ttctaa

DBGET integrated database retrieval system