KEGG   Polaromonas naphthalenivorans: Pnap_0340Help
Entry
Pnap_0340         CDS       T00459                                 

Definition
(GenBank) protein translocase subunit secY/sec61 alpha
  KO
K03076  preprotein translocase subunit SecY
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna02024  Quorum sensing
pna03060  Protein export
pna03070  Bacterial secretion system
Module
pna_M00335  Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:pna00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    Pnap_0340
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    Pnap_0340
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Pnap_0340
Secretion system [BR:pna02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   Pnap_0340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecY DUF1726
Motif
Other DBs
NCBI-ProteinID: ABM35663
UniProt: A1VJ35
Position
338518..339825
Genome map
AA seq 435 aa AA seqDB search
MATNSAQIAKTGKFGDLRNRLVFLLLALVVYRVGAHIPVPGIDPGQLKELFKGQQGGILN
LFNMFSGGALSRFTVFALGIMPYISASIIMQLLTYVVPTFEQMKKEGESGRRKITQYTRY
GTLGLALFQSMGIAVALESSPGLVLMPGFGFRMTAVFSLTAGTMFLMWLGEQITERGLGN
GISILIFAGIAAGLPSALGGLLELVRTGAMSILIAIVIVAVVVLVTYFVVFVERGQRKIL
VNYARRQVGNKVYGGQSSHLPLKLNMAGVIPPIFASSIILLPATVVGWFSTGESMRWLKD
IASTLTPGQPIYVMLYASAIIFFCFFYTALVFNSRETADNLKKSGAFIPGIRPGDQTARY
IDKILVRLTLAGAVYITFVCLLPEFLILKYNVPFYFGGTSLMIIVVVTMDFMAQVQNYMM
SQQYESLLKKANFKT
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaccaactcggctcaaattgcaaaaaccggcaagttcggcgacttgcgcaacagg
cttgtgtttttgctgctggcgctggtcgtgtaccgtgtcggtgcgcatattccagttcca
ggcattgaccccggtcaattgaaggagctgttcaagggccagcagggcggcatattgaac
ttgttcaatatgttctccggtggtgccttgtcaagattcacggtgtttgccttgggcatc
atgccctacatctcggcttccatcatcatgcagctgctgacttatgtggttcccacattc
gagcagatgaaaaaagagggtgaatcgggcaggcgcaagatcacgcagtacacacgttac
ggaacgctagggcttgccctgttccagtcgatgggtattgccgttgcgctggaaagctcg
cctggtttggtgttgatgcctggtttcgggttcaggatgacagcagtgttcagtctgaca
gcgggaacaatgtttctgatgtggttgggcgagcagattactgagcgtggcttgggcaac
ggtatctcaatcctgatttttgcaggtattgcggctggtttgccaagtgcactcggtggt
ttactggaactggtgcgtactggtgccatgagcatattgattgccatcgtgatcgttgcg
gttgttgtgctggtaacgtactttgttgtgtttgttgagcgaggtcaacgcaagattctt
gtgaactatgccaggcgacaagttggtaacaaggtttatggtggacagtcatcgcatttg
cctctgaagctgaacatggcaggcgttattcctcccatttttgcttcctcgattattttg
ctgccagcaacggtggtggggtggtttagcacgggtgaaagcatgcgctggttgaaagac
atcgccagtacgctgacgccgggtcagccgatttatgtgatgctgtacgccagtgcgata
atctttttctgtttcttttacacagctttggtatttaacagccgtgaaactgcagacaac
ctgaaaaagagcggggcgttcattccgggaattcgtccaggtgatcagacggcacgctac
atcgacaagattctggttcgcctgacattggcaggcgcggtttacatcaccttcgtatgt
ttgctgcccgagtttttgattttaaagtacaacgtaccgttttattttggtggaacgtcg
ttgatgattattgttgtggtcactatggatttcatggctcaggttcagaactacatgatg
tcgcagcagtatgagtcgttgctgaaaaaggccaatttcaagacgtga

DBGET integrated database retrieval system