KEGG   Polaromonas naphthalenivorans: Pnap_0344Help
Entry
Pnap_0344         CDS       T00459                                 

Definition
(GenBank) SSU ribosomal protein S4P
  KO
K02986  
small subunit ribosomal protein S4
Organism
pna  Polaromonas naphthalenivorans
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:pna00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Pnap_0344
Ribosome [BR:pna03011]
 Ribosomal Proteins
  Bacteria
   Small subunit
    Pnap_0344
  Archaea
    Pnap_0344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
340964..341587
Genome map
AA seq 207 aa AA seqDB search
MARYLGPKAKLSRREGTDLFLKSARRSISDKAKFDSKPGQHGRTSGTRTSDYGLQLREKQ
KVKRMYGVLEKQFRRYFEEADRRRGNTGANLLSVLESRLDNVVYRMGFGSTRAEARQLVS
HKAMTVNGQSVNIPSYMVKAGDVIAVRDKSKKQTRIAEALELAKQVGLPAWVDVNADKGE
GTFKKVPDRDEFAADINESLIVELYSR
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggcacgttacctcggccccaaggccaaactatcacgccgtgaaggcaccgatcttttc
ctgaaaagcgcccgtcgctcgatcagcgacaaggcaaaattcgactccaagccaggtcag
catggccgtacctccggtacgcgcacttccgactacggtctgcaactgcgtgaaaagcag
aaagtcaagcgcatgtatggcgttcttgaaaagcagttccgccgctacttcgaagaagct
gatcgccgccgtggcaacactggcgccaatttgctgtcggtgctggaatcgcgtctggac
aatgtggtttaccggatgggttttggatcgacacgcgctgaagcgcgccagttggtttcc
cacaaggcaatgaccgtcaacggccagtcggtcaatattccatcttacatggtcaaggcc
ggtgatgtgattgccgttcgcgacaagtctaaaaagcagacgcgcattgctgaagcgctc
gaacttgccaagcaggttggccttcctgcctgggtggatgtcaatgctgacaagggtgaa
ggtaccttcaagaaagtgcctgatcgtgacgaatttgctgccgacatcaacgaatcgttg
atcgtcgagttgtactcacgttaa

DBGET integrated database retrieval system