KEGG   Polaromonas naphthalenivorans: Pnap_0351Help
Entry
Pnap_0351         CDS       T00459                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pna  Polaromonas naphthalenivorans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(347159..347731)
Genome map
AA seq 190 aa AA seqDB search
MASLAPQTLLFDRTALRRDQGLDRPMNSKILRLAIFLVAFSALAACANAQNKPESTCPPA
HGMKAEQLHGRWAVRFTDPPPGLPERATMLLKRHAEFSESLAGTVSRELGRAAGTAAIAG
HSAQAALAGDLDEGMLLLDESSDNISITGTWNGEMKAGSCGQVYQGRWKDTSRSAAPDAP
EVFFTLTKLP
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgctggcaccgcagactcttcttttcgacagaaccgccttgcgccgcgaccaa
ggccttgaccgacccatgaattccaaaatcctccgactcgctatttttttagtagcattc
agcgcccttgcagcctgcgcaaatgcccaaaacaagcctgaatcaacatgcccgccggct
cacggcatgaaagccgaacagctgcatggccgctgggccgtccgctttaccgatccgccg
cctggactgcccgagcgggccacgatgcttctcaagcgccacgccgaattctcggaaagc
ttggccggcacggtcagccgcgaattgggccgtgctgccggcacggcggccatcgctgga
cattcagcccaggccgcgctggccggcgaccttgatgaaggcatgctgctgcttgacgaa
tcgtccgacaacatcagcatcaccggcacctggaacggtgaaatgaaagctggctcgtgc
ggccaggtgtaccagggccgctggaaagataccagccgcagcgccgcgcccgatgcgcct
gaggtctttttcacactgacaaaactgccctga

DBGET integrated database retrieval system