KEGG   Polaromonas naphthalenivorans: Pnap_0353Help
Entry
Pnap_0353         CDS       T00459                                 

Definition
(GenBank) acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
Organism
pna  Polaromonas naphthalenivorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(350042..351274)
Genome map
AA seq 410 aa AA seqDB search
MTLENHNTALDAWIDAHFDEEVQFLQALVRVPTDTPPGNNAPHAERTAELLENFGFEVEK
YPVPTQAVKDYGLESLTNLVVRRQYGPGPVIALNAHGDVVPPGDGWTHDPYGAEIVDGKL
YGRASAVSKSDFASYTFAVRALEALGLPLQGGIELLFTYDEEFGGELGPGWLLKNRLSRP
DLLIAAGFSYQVITAHNGCLQMEVTVHGKMAHAAIPDTGIDALQGATAILTALYLQNQHY
QSITSKVEGITHPYLNVGRIEGGTNTNVVPGKVTLRLDRRMIPEENPAEVEAEVRRVILD
AAATVPGITVEIKRLLMAGAWKPDNRNAALVQALQKHGEAVFGEPIPTSGTPLYTDVRLF
GAAGIPAAIYGAGPRTVLESNAKRADEHLVLEDLRRATKVVARTLLELLQ
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgacccttgagaaccacaacaccgcgcttgacgcctggatcgacgcccatttcgacgaa
gaagtgcaatttctgcaggcgctggtgcgcgtgcccaccgacacgccaccgggcaacaat
gcgccgcacgccgagcgcaccgccgaactgctcgaaaacttcggcttcgaagtggaaaaa
tacccggtgcccacgcaggcagtgaaagattacgggctcgaatcactcaccaacctggtc
gttcgccgccagtacggccccggcccggtcattgccctgaatgcccacggcgacgtggtg
ccgcccggcgatggctggacacacgacccgtatggcgccgagatcgtggacggcaagctc
tatggccgggcgtcggccgtgagcaaaagcgatttcgccagctacaccttcgccgtccgc
gcgcttgaagcgctgggtctgccgctccagggcggcatcgagttgctgttcacctatgac
gaggaattcggcggcgaactcggccccggctggctgctgaaaaacaggctcagccggccc
gacctcttgatcgccgccggcttcagctaccaggtcatcaccgcgcacaacggctgcctg
cagatggaagtgaccgtgcacggcaagatggcccatgccgcgattcccgacaccggcatc
gacgcgctgcagggcgcgaccgccatcctcacggcgctgtatttgcaaaaccagcactac
caatccatcacctccaaagtcgaaggcatcacgcacccctacctcaacgtcggccgcatc
gaaggcggcaccaacaccaatgtggtgcccggcaaggtcacgctcaggctggaccgccgc
atgatccccgaggaaaaccccgccgaggtcgaagccgaagtgcgccgcgtgattcttgat
gccgccgcgaccgtgcccggcatcacggtcgagatcaaacgcctgctgatggccggagcg
tggaaacccgacaatcgcaatgccgcgctggtgcaggcgctgcaaaagcatggcgaagcg
gtcttcggcgagcccattcccacatcaggcacgccgctgtacaccgacgtgcgcctgttc
ggcgcggccggcattccggcagccatttacggcgccggcccgcgcacggtgcttgaaagc
aacgccaagcgcgccgacgagcacctggtcctcgaagacctgcgccgcgcgaccaaggtg
gtggcgcgcacgctgctggagttgctgcagtaa

DBGET integrated database retrieval system