KEGG   Polaromonas naphthalenivorans: Pnap_0357Help
Entry
Pnap_0357         CDS       T00459                                 

Definition
(GenBank) protein of unknown function DUF989
Organism
pna  Polaromonas naphthalenivorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
354524..355741
Genome map
AA seq 405 aa AA seqDB search
MMSAYLPYALDWANLLLRWAHVITAIAWIGSSFYFVFLDSSLTRPVDPDLVAKGVDGELW
AVHGGGFYHPQKYMVAPQQMPDNLHWFYWEAYSTWLTGFALFTVLYLFNAATFLVDKNIY
DWSAGAAIAAALGFLVAGWGVYDTVCRVFGQKKNGDLIVGAGLLVFVVFASWLACQLFAG
RAAFLLVGAMLATAMSANVFVWIIPGQRKVVAQLKAGQPVNPVYGWRAKQRSVHNTYFTL
PVLIAMLSNHYGWLSVGAQNWLVLVLLMLAGALIRHSFVARHKAGVQGRRAPWEYAVAGT
VMLAGLVIWMAPAPPSAAAIAAAAKPAGFAEVKSVIDQRCVMCHNAQLQNKGIALHTPEL
LGQNAQAVYQQAVVLRLMPFNNATQITEDERAVIKRWFEAGAPVN
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcgcctacctgccctatgccctggactgggccaatttgctgctgcgctgggcg
catgtcatcaccgcgattgcctggatcggctcgtcgttctactttgtttttctcgacagc
agcctgaccaggccggttgatcccgacctagttgcaaagggcgtcgatggcgagttgtgg
gcggtgcatggcggcggcttctaccacccgcaaaaatacatggtggcgccccaacagatg
cctgacaacctgcactggttttactgggaggcctactcgacctggctgaccggctttgcc
ctgttcacggtgctttacctgttcaatgccgcgacctttctggtggacaagaacatttac
gactggtcggccggtgcggcgattgctgccgcgctgggctttctggtggccggctggggg
gtgtacgacacggtctgccgggtgttcggccagaaaaaaaacggcgacctgatcgtcggc
gcgggcctgctggtgtttgtcgtttttgcctcgtggctggcctgccagctgtttgccggg
cgggccgcgttcctgctggtcggcgcgatgctggccaccgccatgagcgccaacgtcttc
gtctggatcattccgggccagcgcaaggtggtggcgcagctcaaggccgggcagccggtc
aatccggtctatggctggcgcgccaagcagcgcagcgttcacaacacctatttcacgctg
ccggtgctgatcgcgatgctgtcgaaccactacggctggctgtccgtgggcgcgcagaac
tggctggtgctggtgctcttgatgctggccggcgcgctgatccgccacagtttcgtggcc
cgccacaaggccggggtgcagggcaggcgtgcgccctgggaatacgctgttgcgggcacg
gtgatgctggctggcctggtgatctggatggcgccagcgccgccgtcggccgccgccatc
gccgcagccgccaaaccagccggttttgccgaggtgaaatcggtgatcgaccagcgctgc
gtgatgtgccacaacgcgcagttgcaaaacaagggcattgcgctgcacacgcccgaattg
ctcgggcagaacgcgcaggcggtctatcagcaggctgtcgtgctcaggctcatgcccttc
aacaatgccacgcagatcaccgaagacgagcgcgccgtgatcaagcgctggtttgaagcg
ggcgcgccggtgaactga

DBGET integrated database retrieval system