KEGG   Polaromonas naphthalenivorans: Pnap_0361Help
Entry
Pnap_0361         CDS       T00459                                 

Definition
(GenBank) hypothetical protein
Organism
pna  Polaromonas naphthalenivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-RanBP zf-C3HC DUF35_N OrfB_Zn_ribbon DNA_RNApol_7kD HypA zinc_ribbon_2
Motif
Other DBs
NCBI-ProteinID: ABM35684
UniProt: A1VJ56
Position
360685..361191
Genome map
AA seq 168 aa AA seqDB search
MKPKRLPGFTSFLCPYKKPENWRKASLQANQGNFYGQIQPQPSVYIAWFVVSISLDASHS
QPVQSFSSHVMNNSSSLRCSSCGFSVFNRRYPNCERCGAQLPQDVAYSREEVAALRKRDM
DEELARQAEKRPSPPGKSGDDSWLYFSFSGDSPDSSCSSDGGSCSGAD
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaaaacgcctgccgggtttcacatcatttttatgcccgtataaaaaacctgaa
aattggcggaaagccagtctgcaagccaatcaaggaaacttttatggccagatccaaccg
cagccgtcggtatatatcgcatggtttgtggtatccatttcgttggatgccagccactcg
cagccggtgcaatctttctcttcccacgtcatgaacaactcgtccagcctgaggtgttcc
agttgcgggttttccgtattcaatcgccgttaccctaattgcgagcgttgtggcgcccaa
ctgccgcaggatgtggcttactctcgtgaagaggtcgccgcattgcgaaagcgggacatg
gacgaggagcttgcgcgccaggctgaaaagcgcccgtcgccaccaggcaagagtggcgat
gatagttggctctatttcagtttttcgggcgactccccggacagttcctgctcatccgac
ggtggatcgtgcagcggcgcagactga

DBGET integrated database retrieval system