KEGG   Polaromonas naphthalenivorans: Pnap_0365Help
Entry
Pnap_0365         CDS       T00459                                 

Definition
(GenBank) hypothetical protein
Organism
pna  Polaromonas naphthalenivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3
Motif
Other DBs
NCBI-ProteinID: ABM35688
UniProt: A1VJ60
Position
complement(365438..365770)
Genome map
AA seq 110 aa AA seqDB search
MDALQESCPSFGGAVIATPDGLVLVATRLFSGDTPAACAAGVVAQVDDCLSALKAGRVDA
LMMWTPGGLWFIGRLVNDHVLLLSATDSHCAGAVRLAAQVAVQKLNAVLH
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
ttggatgcgctgcaggagagttgcccgtcttttggcggcgccgtcattgccacgccggat
ggcctggtgctggtggccacccggctgttcagcggagacacgcctgcggcctgcgccgca
ggcgtggtggcacaggtggatgattgcctgtccgcgctgaaagccggacgggtggatgcg
ttgatgatgtggacgcccggtgggctgtggttcattggccgtctggtcaatgaccatgtg
ctgctgctctcggccacggattcgcattgcgcaggcgccgtgcgcctggcggcccaagtg
gccgtacaaaagctcaatgcagtgctgcactaa

DBGET integrated database retrieval system