KEGG   Polaromonas naphthalenivorans: Pnap_0388Help
Entry
Pnap_0388         CDS       T00459                                 

Definition
(GenBank) hypothetical protein
Organism
pna  Polaromonas naphthalenivorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
385516..385935
Genome map
AA seq 139 aa AA seqDB search
MKKSLSVIGLVLVVAAASVACDKIKSPMPELQKSPAPSGQASPPEGERTAFAQAAQKELD
ELKVTIAEFKAKAEASGAQTKTRLGEEVKKLEADLGEAQQRLAALKAATVESWNQVKASF
SSSLEQLKRGVENFRKNPV
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatccttgtcggtcattggcctggtcctcgtggttgccgccgcgtccgttgcg
tgcgacaagatcaagtcgcccatgccggaacttcaaaaatcccctgcgccgtcaggccag
gccagccccccggagggtgagcgcacggcctttgcgcaggccgctcaaaaagagctggac
gagctgaaggtgacgattgccgaattcaaggcaaaagccgaggcttcgggcgcccagacc
aagaccaggcttggcgaggaagtcaaaaaactcgaagccgatctgggtgaagcgcagcag
cgtttggccgcgctgaaagccgccacggtggaatcctggaaccaggtcaaagcgtcgttc
agcagttcgctggagcaactcaagcgcggcgtcgagaactttcgcaagaacccggtctga

DBGET integrated database retrieval system