KEGG   Polaromonas naphthalenivorans: Pnap_0389Help
Entry
Pnap_0389         CDS       T00459                                 

Definition
(GenBank) thermosome subunit
Organism
pna  Polaromonas naphthalenivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cpn60_TCP1 Maf FtsA
Motif
Other DBs
NCBI-ProteinID: ABM35712
UniProt: A1VJ84
Position
385951..387585
Genome map
AA seq 544 aa AA seqDB search
MKPKQLIFHDAARGKIWRGVEALAEAVKVTLGPRGRTVILERDFGPPQIVNSGVLVAKSI
ELEDRFENMGAQLLREVAARTSEMAGDGTTTATVLAHGMIQEGLRYLAGGMNPMDLKRGI
ELAIDTVVAELQRMAKPCASSQEIAHVAAISANNDRSIGDLLASAIDKVGREGAISIEDG
SGLVSVLEVVEGMQFDRGFLSPYFINNAERQSAVLEDVSILLCEGRLTSLNDLLPLLEEV
VKAGRPLLVIAEDVDSDSLAALVINTMRGTLKTCAVKAPGFGDRRKAMVQDIAVLTGGTV
VSDEVGLTLGKVRLQDLGRATRAEITKESTTLIGGAGKPQAIRDRIATIRKERELAASDY
DREKLDERAAKLSGGVALIKVGAATETELKERKLRVEDALHATRAAVEEGIVPGGGVALL
RARRTLAGLTGGTLDETSGIRLVSRALEEPLRRIVSNAGDEPSVILNRVDESPDPAFGYN
AATRAYGDLLQMGVIDPAKVTRLALQNAASIASLILTTDCMIATAPKPSSEEGALNPEGS
SPMF
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccaaacaactcatttttcacgacgctgccaggggaaaaatctggcgcggggtg
gaggcgctggccgaagccgtgaaggtcacgctggggccgcgcgggcgaaccgtgatcctg
gagcgcgacttcggcccgccgcagatcgtcaactccggcgtgctggtggccaagtcgata
gagcttgaggacaggtttgaaaacatgggtgcgcagctgctgcgcgaagtggcggcccgc
accagcgagatggcgggcgacggcaccaccaccgccacggtgctggcccacggcatgatc
caggaggggctgcgctatctggccggcggcatgaatccgatggacctcaagcgcggcatt
gaactggccatcgacacggtggtggccgaactccagcgcatggccaagccctgcgccagc
tcccaggaaatcgcgcatgtggcggcgatatcggccaacaacgaccgctccatcggcgac
ctgctggccagcgccatcgacaaggtggggcgtgaaggcgcgatttccatcgaggacggc
tccgggctggtcagcgtgctggaagtggtcgaaggcatgcagttcgaccggggtttcctg
tcgccgtacttcatcaacaatgcagagcggcaaagcgccgtgctcgaagacgtgtccatc
ttgctgtgtgaaggccggctgacttcgctcaatgacctgttgcctttgctggaggaagtc
gtcaaggccggccgcccgctgctggtgattgccgaggacgtggacagcgactcgctggcg
gcgctggtgatcaacacgatgcgcggcaccctgaaaacctgcgccgtcaaggcgccggga
ttcggcgacaggcgcaaggcgatggtgcaggacattgcggtgctgacgggcggcacggtc
gtcagcgacgaggtcgggttgacgctgggcaaggtcaggctgcaggatctggggcgcgcc
acccgcgccgagatcaccaaggaaagcaccaccctgatcggtggcgcgggcaagccgcag
gcgatcagggacaggattgccaccatccgcaaggagcgcgaactggccgccagcgactac
gaccgcgaaaagctcgacgagcgcgcggccaagctgtcgggcggcgtcgccctgatcaag
gtcggcgcggccacagagaccgagttgaaggagcgcaagctgcgcgttgaagacgccctg
catgccacgcgcgcggcggtggaagagggcatcgttccgggtggcggcgtggccttgttg
cgggcgcgccgcaccctggcggggctgaccggcggcacgctcgatgaaacgtccggtatt
cggctggtgtcgcgcgcgctggaagagcccttgcgccgcatcgtgagcaatgcgggcgac
gagccttcggtgattctcaaccgggttgacgaatcgccggacccggcatttggctacaac
gcggccacgcgcgcctatggcgacctgctgcagatgggggtcatcgacccggccaaggtc
acgcggctggcgctgcaaaatgccgcctccattgccagcctgattctcaccaccgactgc
atgattgccacggcgcccaagccgtcatccgaagagggcgcgctgaatccggaaggcagc
tcgcccatgttttga

DBGET integrated database retrieval system